Overview

  • Product name
    Recombinant Human CFHL2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      EAMFCDFPKINHGILYDEEKYKPFSQVPTGEVFYYSCEYNFVSPSKSFWT RITCAEEGWSPTPKCLRLCFFPFVENGHSESSGQTHLEGDTVQIICNTGY RLQNNENNISCVERGWSTPPKCRSTISAEKCGPPPPIDNGDITSFLLSVY APGSSVEYQCQNLYQLEGNNQITCRNGQWSEPPKCLDPCVISQEIMEKYN IKLKWTNQQKLYSRTGDIVEFVCKSGYHPTKSHSFRAMCQNGKLVYPSCE EK
    • Molecular weight
      54 kDa including tags
    • Amino acids
      19 to 270

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116913 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CFHL2
    • CFHR2
    • Complement factor H related protein 2
    • Complement factor H-related 2
    • Complement factor H-related protein 2
    • DDESK59
    • Factor H-related gene 2
    • FHR 2
    • FHR-2
    • FHR2
    • FHR2_HUMAN
    • H factor (complement)-like 3
    • H factor like 3
    • H factor like protein 2
    • H factor-like 3
    • H factor-like protein 2
    • HFL3
    see all
  • Function
    Might be involved in complement regulation. Can associate with lipoproteins and may play a role in lipid metabolism.
  • Tissue specificity
    Expressed by the liver and secreted in plasma.
  • Sequence similarities
    Contains 4 Sushi (CCP/SCR) domains.
  • Post-translational
    modifications
    N-glycosylated.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116913 at approximately 53.83 kDa.

References

ab116913 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116913.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up