Overview

  • Product name
    Recombinant Human CFHL2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      EAMFCDFPKINHGILYDEEKYKPFSQVPTGEVFYYSCEYNFVSPSKSFWT RITCAEEGWSPTPKCLRLCFFPFVENGHSESSGQTHLEGDTVQIICNTGY RLQNNENNISCVERGWSTPPKCRSTISAEKCGPPPPIDNGDITSFLLSVY APGSSVEYQCQNLYQLEGNNQITCRNGQWSEPPKCLDPCVISQEIMEKYN IKLKWTNQQKLYSRTGDIVEFVCKSGYHPTKSHSFRAMCQNGKLVYPSCE EK
    • Molecular weight
      54 kDa including tags
    • Amino acids
      19 to 270

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116913 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CFHL2
    • CFHR2
    • Complement factor H related protein 2
    • Complement factor H-related 2
    • Complement factor H-related protein 2
    • DDESK59
    • Factor H-related gene 2
    • FHR 2
    • FHR-2
    • FHR2
    • FHR2_HUMAN
    • H factor (complement)-like 3
    • H factor like 3
    • H factor like protein 2
    • H factor-like 3
    • H factor-like protein 2
    • HFL3
    see all
  • Function
    Might be involved in complement regulation. Can associate with lipoproteins and may play a role in lipid metabolism.
  • Tissue specificity
    Expressed by the liver and secreted in plasma.
  • Sequence similarities
    Contains 4 Sushi (CCP/SCR) domains.
  • Post-translational
    modifications
    N-glycosylated.
  • Cellular localization
    Secreted.
  • Information by UniProt

Recombinant Human CFHL2 protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116913 at approximately 53.83 kDa.

References for Recombinant Human CFHL2 protein (ab116913)

ab116913 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116913.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up