Overview

  • Product nameRecombinant Human CFHL2 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP36980
    • SpeciesHuman
    • SequenceEAMFCDFPKINHGILYDEEKYKPFSQVPTGEVFYYSCEYNFVSPSKSFWT RITCAEEGWSPTPKCLRLCFFPFVENGHSESSGQTHLEGDTVQIICNTGY RLQNNENNISCVERGWSTPPKCRSTISAEKCGPPPPIDNGDITSFLLSVY APGSSVEYQCQNLYQLEGNNQITCRNGQWSEPPKCLDPCVISQEIMEKYN IKLKWTNQQKLYSRTGDIVEFVCKSGYHPTKSHSFRAMCQNGKLVYPSCE EK
    • Molecular weight54 kDa including tags
    • Amino acids19 to 270

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116913 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CFHL2
    • CFHR2
    • Complement factor H related protein 2
    • Complement factor H-related 2
    • Complement factor H-related protein 2
    • DDESK59
    • Factor H-related gene 2
    • FHR 2
    • FHR-2
    • FHR2
    • FHR2_HUMAN
    • H factor (complement)-like 3
    • H factor like 3
    • H factor like protein 2
    • H factor-like 3
    • H factor-like protein 2
    • HFL3
    see all
  • FunctionMight be involved in complement regulation. Can associate with lipoproteins and may play a role in lipid metabolism.
  • Tissue specificityExpressed by the liver and secreted in plasma.
  • Sequence similaritiesContains 4 Sushi (CCP/SCR) domains.
  • Post-translational
    modifications
    N-glycosylated.
  • Cellular localizationSecreted.
  • Information by UniProt

Recombinant Human CFHL2 protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116913 at approximately 53.83 kDa.

References for Recombinant Human CFHL2 protein (ab116913)

ab116913 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116913.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"