Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      FGWDVPVILRNSEETQFSTRVFKKQMRQVKNPFGLEITNPSSASITTGIT LTTDCLEDSLLTCYWGCNVQKLYEALQKHVYCFRISTPQALEDALYSEYL YQEQYFIKKDSKEEIYCQLPRDTKIEDFGTVPRSRYPLVALLTLADEDDR EIYDIISMVSVIHIPDRTYKLSCRILYQYLLLAQGQFHDLKQLFMSANNN FTPSNNSSSEEKNTDRSLLEKVGLSESEVEPSEENSKDCVVCQNGTVNWV LLPCRHTCLCDGCVKYFQQCPMCRQFVQESFALCSQKEQDKDKPKTL
    • Amino acids
      36 to 332
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161100 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cell growth regulator with ring finger domain 1
    • Cell growth regulator with RING finger domain protein 1
    • Cell growth regulatory gene 19 protein
    • Cell growth regulatory with ring finger domain
    • CGRRF 1
    • CGRRF1
    • RING finger protein 197
    • RNF197
    see all
  • Relevance
    CGR19 is involved in the negative regulation of cell proliferation and cell cycle arrest in response to stress.
  • Cellular localization
    Nuclear

Images

  • ab161100 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161100 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161100.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up