Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      AALVQDYVQMKASELEQEQEREGSSLDSPRSKRCGNLSTCMLGTYTQDFN KFHTFPQTAIGVGAPGKKRDMSSDLERDHRPHVSMPQNAN
    • Amino acids
      52 to 141
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158017 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Calcitonin/calcitonin related polypeptide alpha
    • Alpha type CGRP
    • Beta type CGRP
    • CALC1
    • CALC2
    • CALCA
    • CALCB
    • Calcitonin 1
    • Calcitonin 2
    • Calcitonin gene related peptide I
    • Calcitonin gene related peptide II
    • Calcitonin related polypeptide alpha
    • Calcitonin related polypeptide beta
    • CGRP
    • CGRP I
    • CGRP II
    • CGRP1
    • CGRP2
    • CT
    • Katacalcin
    • KC
    see all
  • Relevance
    CGRP is present in C-cells of the thyroid and in central and peripheral nerves. CGRP has several important physiologic roles: it is a potent vasodilator, and can affect the force and rate of heart beat; it can modulate acetylcholine receptor function at the neuromuscular junction; it has been demonstrated to block tolerance to morphine; and it can modulate antigen presentation in Langerhans cells in the skin. Despite these important physiologic functions, therapeutic strategies using CGRP have been impeded due to the lack of a cloned CGRP receptor with which ligands could be developed.
  • Cellular localization
    Endoplasmic reticulum and Secreted

Images

  • ab158017 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158017 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158017.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up