Overview

  • Product name
    Recombinant Human Chd1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      IKALKDSSSGTERTGGRLGKVKGPTFRISGVQVNAKLVISHEEELIPLHK SIPSDPEERKQYTIPCHTKAAHFDIDWGKEDDSNLLIGIYEYGYGS
    • Molecular weight
      36 kDa including tags
    • Amino acids
      1177 to 1272

Specifications

Our Abpromise guarantee covers the use of ab117050 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ATP dependent helicase CHD 1
    • ATP-dependent helicase CHD1
    • CHD 1
    • CHD-1
    • Chd1
    • CHD1_HUMAN
    • Chromodomain helicase DNA binding protein 1
    • Chromodomain-helicase-DNA-binding protein 1
    • DKFZp686E2337
    • OTTHUMP00000222625
    see all
  • Function
    ATP-dependent chromatin-remodeling factor which functions as substrate recognition component of the transcription regulatory histone acetylation (HAT) complex SAGA. Regulates polymerase II transcription. Also required for efficient transcription by RNA polymerase I, and more specifically the polymerase I transcription termination step. Regulates negatively DNA replication. Not only involved in transcription-related chromatin-remodeling, but also required to maintain a specific chromatin configuration across the genome. Is also associated with histone deacetylase (HDAC) activity (By similarity). Required for the bridging of SNF2, the FACT complex, the PAF complex as well as the U2 snRNP complex to H3K4me3. Functions to modulate the efficiency of pre-mRNA splicing in part through physical bridging of spliceosomal components to H3K4me3. Required for maintaining open chromatin and pluripotency in embryonic stem cells.
  • Sequence similarities
    Belongs to the SNF2/RAD54 helicase family.
    Contains 2 chromo domains.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
  • Domain
    The 2 chromodomains are involved in the binding to the histone H3 methyllysine at position 4 (H3K4me3).
  • Cellular localization
    Nucleus. Cytoplasm. Is released into the cytoplasm when cells enter mitosis and is reincorporated into chromatin during telophase-cytokinesis.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab117050 at approximately 36.19 kDa.
    Stained with Coomassie Blue.

References

ab117050 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab117050.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up