Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO14647
    • SpeciesHuman
    • SequenceMMRNKDKSQEEDSSLHSNASSHSASEEASGSDSGSQSESEQGSDPGSGHG SESNSSSESSESQSESESESAGSKSQPVLPEAKEKPASKKERIADVKKMW EEYPDVYGVRRSNRSRQEPSRFNIKEEASSGSESGSPKRRGQRQLKKQEK WKQEPSEDEQEQGTSAESEPEQKKVKARRPVPRRTVPKPRVKKQPKTQRG KRKKQDSSDEDDDDDEAPKRQTRRRAAKNVSYKEDDDFETDSDDLIEMTG EGVDEQQDNSETIEKVLDSRLGKKGATGASTTVYAIEANGDPSGDFDTEK DEGEIQYLIKWKGWSYIHSTWESEESLQQQKVKGLKKLENFKKKEDEIKQ WLGKVSPEDVEYFNCQQELASELNKQYQIVERVIAVKTSKSTLGQTDFPA HSRKPAPSNEPEYLCKWMGLPYSECSWEDEALIGKKFQNCIDSFHSRNNS KTIPTRECKALKQRPRFVALKKQPAYLGGENLELRDYQLEGLNWLAHSWC K
    • Molecular weight81 kDa including tags
    • Amino acids1 to 501

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114689 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2810013C04Rik
    • 2810040A01Rik
    • 5630401D06Rik
    • AI851092
    • ATP dependent helicase CHD2
    • ATP-dependent helicase CHD2
    • BC029703
    • CHD 2
    • CHD-2
    • CHD2
    • CHD2_HUMAN
    • chromodomain helicase dna binding protein
    • Chromodomain-helicase-DNA-binding protein 2
    • DKFZp547I1315
    • DKFZp686E01200
    • DKFZP781D1727
    • EC 3.6.1.-
    • EEOC
    • FLJ38614
    see all
  • FunctionSequence-selective DNA-binding protein.
  • Sequence similaritiesBelongs to the SNF2/RAD54 helicase family.
    Contains 2 chromo domains.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human CHD2 protein images

  • ab114689 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human CHD2 protein (ab114689)

ab114689 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114689.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"