Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ14839
    • SpeciesHuman
    • SequenceETEPKGAADVEKVEEKSAIDLTPIVVEDKEEKKEEEEKKEVMLQNGETPK DLNDEKQKKNIKQRFMFNIADGGFTELHSLWQNEERAATVTKKTYEIWH
    • Molecular weight37 kDa including tags
    • Amino acids1632 to 1730

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114276 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • ATP dependent helicase CHD4
    • ATP-dependent helicase CHD4
    • CHD 4
    • CHD-4
    • CHD4
    • CHD4_HUMAN
    • Chromodomain helicase DNA binding protein 4
    • Chromodomain-helicase-DNA-binding protein 4
    • Mi 2 autoantigen 218 kDa protein
    • Mi 2b
    • Mi-2 autoantigen 218 kDa protein
    • Mi2 beta
    • Mi2-beta
    see all
  • FunctionComponent of the histone deacetylase NuRD complex which participates in the remodeling of chromatin by deacetylating histones.
  • Sequence similaritiesBelongs to the SNF2/RAD54 helicase family.
    Contains 2 chromo domains.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
    Contains 2 PHD-type zinc fingers.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localizationNucleus. Cytoplasm > cytoskeleton > centrosome. Associates with centrosomes in interphase.
  • Information by UniProt

Recombinant Human CHD4 protein images

  • 12.5% SDS-PAGE analysis of CHD4 protein (ab114276). Stained with Coomassie Blue.

References for Recombinant Human CHD4 protein (ab114276)

ab114276 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114276.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"