Recombinant Human Chemerin protein (ab104356)
Key features and details
- Expression system: Escherichia coli
- Purity: > 98% SDS-PAGE
- Endotoxin level: < 0.100 Eu/µg
- Suitable for: Functional Studies, SDS-PAGE
Description
-
Product name
Recombinant Human Chemerin protein
See all Chemerin proteins and peptides -
Biological activity
Determined by its ability to chemoattract human immature dendritic cells using a concentration range of 1.0-100.0 ng/ml. -
Purity
> 98 % SDS-PAGE.
Purity > 98% by SDS-PAGE gel and HPLC analyses. Sterile filtered through a 0.2 micron filter. -
Endotoxin level
< 0.100 Eu/µg -
Expression system
Escherichia coli -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
ELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEF KLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIE TQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFA -
Predicted molecular weight
16 kDa -
Amino acids
21 to 155
-
Specifications
Our Abpromise guarantee covers the use of ab104356 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
-
Form
Lyophilized -
Additional notes
Determined by its ability to chemoattract human immature dendritic cells using a concentration range of 1.0-100.0 ng/ml.
Reconstitute in water to a concentration of 0.1-1.0 mg/ml. Do not vortex. This solution can be stored at 2-8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C or -80°C. Avoid freeze / thaw cycle. Please see notes section.
-
ReconstitutionReconstitute in water to a concentration of 0.1-1.0 mg/ml. Do not vortex. This solution can be stored at 2-8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C.
General Info
-
Alternative names
- HP10433
- RAR responsive protein TIG2
- RAR-responsive protein TIG2
see all -
Tissue specificity
Highly expressed in skin (basal and suprabasal layers of the epidermis, hair follicles and endothelial cells). Also found in pancreas, liver, spleen, prostate, ovary, small intestine and colon. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (1)
ab104356 has been referenced in 1 publication.
- Tobin SW et al. Heart Failure and MEF2 Transcriptome Dynamics in Response to ß-Blockers. Sci Rep 7:4476 (2017). PubMed: 28667250