Recombinant Human Chemerin protein (ab104356)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      ELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEF KLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIE TQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFA
    • Molecular weight
      16 kDa
    • Amino acids
      21 to 155

Specifications

Our Abpromise guarantee covers the use of ab104356 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Determined by its ability to chemoattract human immature dendritic cells using a concentration range of 1.0-100.0 ng/ml.
  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level
    < 0.100 Eu/µg
  • Purity
    > 98 % SDS-PAGE.
    Purity > 98% by SDS-PAGE gel and HPLC analyses. Sterile filtered through a 0.2 micron filter.
  • Form
    Lyophilised
  • Additional notes
    Determined by its ability to chemoattract human immature dendritic cells using a concentration range of 1.0-100.0 ng/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C or -80°C. Avoid freeze / thaw cycle. Please see notes section.

    Preservative: None

  • Reconstitution
    Reconstitute in water to a concentration of 0.1-1.0 mg/ml. Do not vortex. This solution can be stored at 2-8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C.

General Info

  • Alternative names
    • HP10433
    • RAR responsive protein TIG2
    • RAR-responsive protein TIG2
    • RARR2_HUMAN
    • RARRES2
    • Retinoic acid receptor responder (tazarotene induced) 2
    • Retinoic acid receptor responder 2
    • Retinoic acid receptor responder protein 2
    • Tazarotene induced gene 2 protein
    • Tazarotene-induced gene 2 protein
    • TIG2
    see all
  • Tissue specificity
    Highly expressed in skin (basal and suprabasal layers of the epidermis, hair follicles and endothelial cells). Also found in pancreas, liver, spleen, prostate, ovary, small intestine and colon.
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab104356 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab104356.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up