Recombinant Human Chemerin protein (ab104356)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ99969
    • SpeciesHuman
    • SequenceELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEF KLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIE TQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFA
    • Molecular weight16 kDa
    • Amino acids21 to 155

Specifications

Our Abpromise guarantee covers the use of ab104356 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityDetermined by its ability to chemoattract human immature dendritic cells using a concentration range of 1.0-100.0 ng/ml.
  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level< 0.100 Eu/µg
  • Purity> 98 % SDS-PAGE.
    Purity > 98% by SDS-PAGE gel and HPLC analyses. Sterile filtered through a 0.2 micron filter.
  • FormLyophilised
  • Additional notes Determined by its ability to chemoattract human immature dendritic cells using a concentration range of 1.0-100.0 ng/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C or -80°C. Avoid freeze / thaw cycle. Please see notes section.

    Preservative: None

  • ReconstitutionReconstitute in water to a concentration of 0.1-1.0 mg/ml. Do not vortex. This solution can be stored at 2-8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C.

General Info

  • Alternative names
    • HP10433
    • RAR responsive protein TIG2
    • RAR-responsive protein TIG2
    • RARR2_HUMAN
    • RARRES2
    • Retinoic acid receptor responder (tazarotene induced) 2
    • Retinoic acid receptor responder 2
    • Retinoic acid receptor responder protein 2
    • Tazarotene induced gene 2 protein
    • Tazarotene-induced gene 2 protein
    • TIG2
    see all
  • Tissue specificityHighly expressed in skin (basal and suprabasal layers of the epidermis, hair follicles and endothelial cells). Also found in pancreas, liver, spleen, prostate, ovary, small intestine and colon.
  • Cellular localizationSecreted.
  • Information by UniProt

References for Recombinant Human Chemerin protein (ab104356)

ab104356 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab104356.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"