Recombinant Human Chemerin protein (ab157064)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      ELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEF KLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIE TQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFS
    • Molecular weight
      20 kDa
    • Amino acids
      21 to 157
    • Tags
      DDDDK tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157064 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 0.100 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

    Constituent: 99% PBS

  • Reconstitution
    Reconstitute with 100µl sterile water. 0.1mg/ml after reconstitution. Further dilutions should be made with medium containing 5% fetal calf serum or a carrier protein.

General Info

  • Alternative names
    • HP10433
    • RAR responsive protein TIG2
    • RAR-responsive protein TIG2
    • RARR2_HUMAN
    • RARRES2
    • Retinoic acid receptor responder (tazarotene induced) 2
    • Retinoic acid receptor responder 2
    • Retinoic acid receptor responder protein 2
    • Tazarotene induced gene 2 protein
    • Tazarotene-induced gene 2 protein
    • TIG2
    see all
  • Tissue specificity
    Highly expressed in skin (basal and suprabasal layers of the epidermis, hair follicles and endothelial cells). Also found in pancreas, liver, spleen, prostate, ovary, small intestine and colon.
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab157064 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157064.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up