Recombinant Human Chemerin protein (His tag) (ab224790)

Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected insect cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      ADPELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVR LEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHC PIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFSHHHHHH
    • Molecular weight
      17 kDa including tags
    • Amino acids
      21 to 157
    • Tags
      His tag C-Terminus
    • Additional sequence information
      This product is the mature full length protein from aa 21 to 157. The signal peptide and propeptide are not included (NP_002880).

Specifications

Our Abpromise guarantee covers the use of ab224790 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >90% by SDS-PAGE.
    ab224790 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 10% Glycerol, PBS

General Info

  • Alternative names
    • HP10433
    • RAR responsive protein TIG2
    • RAR-responsive protein TIG2
    • RARR2_HUMAN
    • RARRES2
    • Retinoic acid receptor responder (tazarotene induced) 2
    • Retinoic acid receptor responder 2
    • Retinoic acid receptor responder protein 2
    • Tazarotene induced gene 2 protein
    • Tazarotene-induced gene 2 protein
    • TIG2
    see all
  • Tissue specificity
    Highly expressed in skin (basal and suprabasal layers of the epidermis, hair follicles and endothelial cells). Also found in pancreas, liver, spleen, prostate, ovary, small intestine and colon.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab224790.

    MW: 18-28 kDa (SDS-PAGE under reducing conditions).

References

ab224790 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224790.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up