Recombinant Human Chemerin protein (Tagged) (ab226239)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      ELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEF KLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIE TQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFS
    • Molecular weight
      32 kDa including tags
    • Amino acids
      21 to 157
    • Tags
      His tag N-Terminus
    • Additional sequence information
      N-terminal 6xHis-SUMO-tagged.

Specifications

Our Abpromise guarantee covers the use of ab226239 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names
    • HP10433
    • RAR responsive protein TIG2
    • RAR-responsive protein TIG2
    • RARR2_HUMAN
    • RARRES2
    • Retinoic acid receptor responder (tazarotene induced) 2
    • Retinoic acid receptor responder 2
    • Retinoic acid receptor responder protein 2
    • Tazarotene induced gene 2 protein
    • Tazarotene-induced gene 2 protein
    • TIG2
    see all
  • Tissue specificity
    Highly expressed in skin (basal and suprabasal layers of the epidermis, hair follicles and endothelial cells). Also found in pancreas, liver, spleen, prostate, ovary, small intestine and colon.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

References

ab226239 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab226239.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up