Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GSNSAPPIPDSRLGEENKGHQMLVKMGWSGSGGLGAKEQGIQDPIKGGDV RDKWDQYKGVGVALDDPYENYRRNKSYSFIARMKARDEC
    • Amino acids
      795 to 883
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161036 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Calcium homeostasis endoplasmic reticulum protein
    • DAN16
    • DAN26
    • ERPROT 213 21
    • ERPROT21321
    • Protein with polyglutamine repeat
    • SCAF6
    • SR related CTD associated factor 6
    • SRA1
    see all
  • Relevance
    The Calcium homoeostasis endoplasmic reticulum protein (CHERP) gene has been recently identified and localized on chromosome 19p13.1. CHERP has high homology to an SR related CTD protein, which is known to interact with the largest subunit of RNA polymerase II. CHERP is an integral endoplasmic reticulum membrane protein is involved in calcium mobilization induced by thrombin. Confocal microscopy revealed that CHERP is associated with Ins(1,4,5)P3 receptor throughout the cytoplasm and perinuclear region in Jurkat T lymphocyte. CHERP Anti sense treatment induced a decrease in CHERP, which caused an impaired increase in free cytoplasmic calcium but calcium influx remains unaffected, with some deficient in endoplasmic reticulum calcium stores. In the CHERP depleted Jurkat T lymphocytes the calcium dependent translocation of nuclear factor of activated T cells (NFAT) from cytoplasm to nucleus was also suppressed with significant suppression of cell.
  • Cellular localization
    Cytoplasm. Cytoplasm; perinuclear region. Endoplasmic reticulum. Note: Distributed throughout the cytoplasm and also localizes to the perinuclear region of both human erythroleukemia (HEL) cells and Jurkat cells. Colocalizes with ITPR1.

Images

  • ab161036 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161036 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161036.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up