Recombinant Human CHI3L2 protein (ab158109)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGATTMDQKSLWAGVVVLLLLQGGSAYKLVCYFTNWSQDRQEPGKFTPEN IDPFLCSHLIYSFASIENNKVIIKDKSEVMLYQTINSLKTKNPKLKILLS IGGYLFGSKGFHPMVDSSTSRLEFINSIILFLRNHNFDGLDVSWIYPDQK ENTHFTVLIHELAEAFQKDFTKSTKERLLLTVGVSAGRQMIDNSYQVEKL AKDLDFINLLSFDFHGSWEKPLITGHNSPLSKGWQDRGPSSYYNVEYAVG YWIHKGMPSEKVVMGIPTYGHSFTLASAETTVGAPASGPGAAGPITESSG FLAYYEICQFLKGAKITRLQDQQVPYAVKGNQWVGYDDVKSMETKVQFLK NLNLGGAMIWSIDMDDFTGKSCNQGPYPLVQAVKRSLGSL
    • Amino acids
      1 to 390
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158109 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CH3L2_HUMAN
    • CHI3L2
    • Chitinase 3 like 2
    • Chitinase-3-like protein 2
    • Chondrocyte protein 39
    • OTTHUMP00000014028
    • YKL 39
    • YKL-39
    • YKL39
    see all
  • Function
    May bind glycan structure with high affinity, but not heparin. Has no chitotriosidase activity.
  • Tissue specificity
    Highest expression in chondrocytes, followed by synoviocytes, lung and heart. Not detected in spleen, pancreas, and liver. May also be expressed in developing brain and placenta.
  • Sequence similarities
    Belongs to the glycosyl hydrolase 18 family.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab158109 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158109 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158109.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up