Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MVRSVAWAGFMVLLMIPWGSAAKLVCYFTNWAQYRQGEARFLPKDLDPSL CTHLIYAFAGMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWN FSTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAV DKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKI AQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEESGAAASLNVDAAVQQW LQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGM LAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQK GLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQELSLPYLPSGTPELEVP KPGQPSEPEHGPSPGQDTFCQGKADGLYPNPRERSSFYSCAGGRLFQQSC PTGLVFSNSCKCCTWN
    • Molecular weight
      77 kDa including tags
    • Amino acids
      1 to 466

Specifications

Our Abpromise guarantee covers the use of ab116981 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CHI3
    • CHIT
    • CHIT1
    • CHIT1_HUMAN
    • CHITD
    • Chitinase 1
    • Chitinase 1 (chitotriosidase)
    • Chitinase-1
    • Chitotriosidase
    • Chitotriosidase-1
    • EC 3.2.1.14
    • FLJ00314
    • MGC125322
    • Plasma methylumbelliferyl tetra N acetylchitotetraoside hydrolase
    see all
  • Function
    Degrades chitin, chitotriose and chitobiose. May participate in the defense against nematodes and other pathogens. Isoform 3 has no enzymatic activity.
  • Tissue specificity
    Detected in spleen. Secreted by cultured macrophages.
  • Sequence similarities
    Belongs to the glycosyl hydrolase 18 family. Chitinase class II subfamily.
    Contains 1 chitin-binding type-2 domain.
  • Cellular localization
    Secreted. Lysosome. A small proportion is lysosomal.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab116981 at approximately 77.33kDa.
    Stained with Coomassie Blue.

References

ab116981 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116981.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up