Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MVRSVAWAGFMVLLMIPWGSAAKLVCYFTNWAQYRQGEARFLPKDLDPSL CTHLIYAFAGMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWN FSTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAV DKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKI AQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEESGAAASLNVDAAVQQW LQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGM LAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQK GLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQELSLPYLPSGTPELEVP KPGQPSEPEHGPSPGQDTFCQGKADGLYPNPRERSSFYSCAGGRLFQQSC PTGLVFSNSCKCCTWN
    • Molecular weight
      77 kDa including tags
    • Amino acids
      1 to 466

Specifications

Our Abpromise guarantee covers the use of ab116981 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CHI3
    • CHIT
    • CHIT1
    • CHIT1_HUMAN
    • CHITD
    • Chitinase 1
    • Chitinase 1 (chitotriosidase)
    • Chitinase-1
    • Chitotriosidase
    • Chitotriosidase-1
    • EC 3.2.1.14
    • FLJ00314
    • MGC125322
    • Plasma methylumbelliferyl tetra N acetylchitotetraoside hydrolase
    see all
  • Function
    Degrades chitin, chitotriose and chitobiose. May participate in the defense against nematodes and other pathogens. Isoform 3 has no enzymatic activity.
  • Tissue specificity
    Detected in spleen. Secreted by cultured macrophages.
  • Sequence similarities
    Belongs to the glycosyl hydrolase 18 family. Chitinase class II subfamily.
    Contains 1 chitin-binding type-2 domain.
  • Cellular localization
    Secreted. Lysosome. A small proportion is lysosomal.
  • Information by UniProt

Recombinant Human CHIT1 protein images

  • 12.5% SDS-PAGE showing ab116981 at approximately 77.33kDa.
    Stained with Coomassie Blue.

References for Recombinant Human CHIT1 protein (ab116981)

ab116981 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116981.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up