Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ13231
    • SpeciesHuman
    • SequenceGMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDM VATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLV QDLANAFQQE
    • Molecular weight38 kDa including tags
    • Amino acids60 to 169

Specifications

Our Abpromise guarantee covers the use of ab116982 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CHI3
    • CHIT
    • CHIT1
    • CHIT1_HUMAN
    • CHITD
    • Chitinase 1
    • Chitinase 1 (chitotriosidase)
    • Chitinase-1
    • Chitotriosidase
    • Chitotriosidase-1
    • EC 3.2.1.14
    • FLJ00314
    • MGC125322
    • Plasma methylumbelliferyl tetra N acetylchitotetraoside hydrolase
    see all
  • FunctionDegrades chitin, chitotriose and chitobiose. May participate in the defense against nematodes and other pathogens. Isoform 3 has no enzymatic activity.
  • Tissue specificityDetected in spleen. Secreted by cultured macrophages.
  • Sequence similaritiesBelongs to the glycosyl hydrolase 18 family. Chitinase class II subfamily.
    Contains 1 chitin-binding type-2 domain.
  • Cellular localizationSecreted. Lysosome. A small proportion is lysosomal.
  • Information by UniProt

Recombinant Human CHIT1 protein images

  • 12.5% SDS-PAGE showing ab116982 at approximately 37.73kDa.
    Stained with Coomassie Blue.

References for Recombinant Human CHIT1 protein (ab116982)

ab116982 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116982.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"