Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEW NDETLYQEFNGLKKMNPKLKTLLAIGGWNFSTQKFTDMVATANNRQTFVN SAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQ TSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKV TGHNSPLYKRQEESGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSF TLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQK VPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCN QGRYPLIQTLRQELSLPYLPSGTPELEVPKPGQPSEPEHGPSPGQDTFCQ GKADGLYPNPRERSSFYSCAGGRLFQQSCPTGLVFSNSCKCCTWNVDHHH HHH
    • Molecular weight
      50 kDa including tags
    • Amino acids
      22 to 466
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151883 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. ab151883 is supplied as a 0.2 µm filtered solution.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.50
    Constituents: 0.32% Tris HCl, 0.88% Sodium chloride

General Info

  • Alternative names
    • CHI3
    • CHIT
    • CHIT1
    • CHIT1_HUMAN
    • CHITD
    • Chitinase 1
    • Chitinase 1 (chitotriosidase)
    • Chitinase-1
    • Chitotriosidase
    • Chitotriosidase-1
    • EC 3.2.1.14
    • FLJ00314
    • MGC125322
    • Plasma methylumbelliferyl tetra N acetylchitotetraoside hydrolase
    see all
  • Function
    Degrades chitin, chitotriose and chitobiose. May participate in the defense against nematodes and other pathogens. Isoform 3 has no enzymatic activity.
  • Tissue specificity
    Detected in spleen. Secreted by cultured macrophages.
  • Sequence similarities
    Belongs to the glycosyl hydrolase 18 family. Chitinase class II subfamily.
    Contains 1 chitin-binding type-2 domain.
  • Cellular localization
    Secreted. Lysosome. A small proportion is lysosomal.
  • Information by UniProt

References

ab151883 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151883.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up