Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAVPFVEDWDLVQTLGEGAYGEVQLAVNRVTEEAVAVKIVDMKRAVDCPE NIKKEICINKMLNHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDI GMPEPDAQRFFHQLMAGVVYLHGIGITHRDIKPENLLLDERDNLKISDFG LATVFRYNNRERLLNKMCGTLPYVAPELLKRREFHAEPVDVWSCGIVLTA MLAGELPWDQPSDSCQEYSDWKEKKTYLNPWKKIDSAPLALLHKILVENP SARITIPDIKKDRWYNKPLKKGAKRPRVTSGGVSESPSGFSKHIQSNLDF SPVNSASSEENVKYSSSQPEPRTGLSLWDTSPSYIDKLVQGISFSQPTCP DHMLLNSQLLGTPGSSQNPWQRLVKRMTRFFTKLDADKPYQCLKETREKL GYQWKKSCMNQVTISTTDRRNNKLIFKVNLLEMDDKILVDFRLSKGDGLE FKRHFLKIKGKLIDIVSSQKVWLPAT
    • Amino acids
      1 to 476
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158106 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C85740
    • Cell cycle checkpoint kinase
    • Checkpoint , S. pombe, homolog of, 1
    • Checkpoint kinase 1
    • Checkpoint kinase 1 homolog (S. pombe)
    • CHEK 1
    • Chek1
    • Chk 1
    • Chk1
    • CHK1 checkpoint homolog (S. pombe)
    • CHK1_HUMAN
    • EC 2.7.11.1
    • rad27
    • Serine/threonine protein kinase Chk1
    • Serine/threonine-protein kinase CHK1
    • STT3, subunit of the oligosaccharyltransferase complex, homolog A (S. cerevisiae)
    see all
  • Information by UniProt

Images

  • ab158106 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158106 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158106.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up