Overview

  • Product name
    Recombinant Human CHKL protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAAEATAVAGSGAVGGCLAKDGLQQSKCPDTTPKRRRASSLSRDAERRAY QWCREYLGGAWRRVQPEELRVYPVSGGLSNLLFRCSLPDHLPSVGEEPRE VLLRLYGAILQGVDSLVLESVMFAILAERSLGPQLYGVFPEGRLEQYIPS RPLKTQELREPVLSAAIATKMAQFHGMEMPFTKEPHWLFGTMERYLKQIQ DLPPTGLPEMNLLEMYSLKDEMGNLRKLLESTPSPVVFCHNDIQEGNILL LSEPENADSLMLVDFEYSSYNYRGFDIGNHFCEWVYDYTHEEWPFYKARP TDYPTQEQQLHFIRHYLAEAKKGETLSQEEQRKLEEDLLVEVSRYALASH FFWGLWSILQASMSTIEFGYLDYAQSRFQFYFQQKGQLTSVHSSS
    • Molecular weight
      70 kDa including tags
    • Amino acids
      1 to 395

Specifications

Our Abpromise guarantee covers the use of ab117004 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • CHETK
    • Chetk-beta
    • Chkb
    • Chkb choline kinase beta
    • Chkb protein
    • CHKB_HUMAN
    • CHKL
    • Choline kinase beta
    • Choline kinase-like
    • Choline kinase-like protein
    • Choline/ethanolamine kinase
    • choline/ethanolamine kinase beta
    • Choline/ethanolamine kinase, beta
    • CK
    • CK/EK
    • CK/EK-beta
    • CKB
    • CKEKB
    • EK
    • EKB
    • Ethanolamine kinase
    • Ethanolamine kinase beta
    • Ethanolamine kinase, beta
    • MDCMC
    see all
  • Function
    Has a key role in phospholipid biosynthesis. Catalyzes the first step in phosphatidylethanolamine biosynthesis. Phosphorylates ethanolamine, and can also act on choline (in vitro). Has higher activity with ethanolamine. May not significantly contribute to in vivo phosphatidylcholine biosynthesis.
  • Pathway
    Phospholipid metabolism; phosphatidylethanolamine biosynthesis; phosphatidylethanolamine from ethanolamine: step 1/3.
  • Sequence similarities
    Belongs to the choline/ethanolamine kinase family.
  • Information by UniProt

Recombinant Human CHKL protein images

  • 12.5% SDS-PAGE showing ab117004 at approx. 69.52 kDa.
    Stained with Coomassie Blue.

References for Recombinant Human CHKL protein (ab117004)

ab117004 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117004.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up