Overview

  • Product nameRecombinant Human CHKL protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ9Y259
    • SpeciesHuman
    • SequenceMAAEATAVAGSGAVGGCLAKDGLQQSKCPDTTPKRRRASSLSRDAERRAY QWCREYLGGAWRRVQPEELRVYPVSGGLSNLLFRCSLPDHLPSVGEEPRE VLLRLYGAILQGVDSLVLESVMFAILAERSLGPQLYGVFPEGRLEQYIPS RPLKTQELREPVLSAAIATKMAQFHGMEMPFTKEPHWLFGTMERYLKQIQ DLPPTGLPEMNLLEMYSLKDEMGNLRKLLESTPSPVVFCHNDIQEGNILL LSEPENADSLMLVDFEYSSYNYRGFDIGNHFCEWVYDYTHEEWPFYKARP TDYPTQEQQLHFIRHYLAEAKKGETLSQEEQRKLEEDLLVEVSRYALASH FFWGLWSILQASMSTIEFGYLDYAQSRFQFYFQQKGQLTSVHSSS
    • Molecular weight70 kDa including tags
    • Amino acids1 to 395

Associated products

Specifications

Our Abpromise guarantee covers the use of ab117004 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • CHETK
    • Chetk-beta
    • Chkb
    • Chkb choline kinase beta
    • Chkb protein
    • CHKB_HUMAN
    • CHKL
    • Choline kinase beta
    • Choline kinase-like
    • Choline kinase-like protein
    • Choline/ethanolamine kinase
    • choline/ethanolamine kinase beta
    • Choline/ethanolamine kinase, beta
    • CK
    • CK/EK
    • CK/EK-beta
    • CKB
    • CKEKB
    • EK
    • EKB
    • Ethanolamine kinase
    • Ethanolamine kinase beta
    • Ethanolamine kinase, beta
    • MDCMC
    see all
  • FunctionHas a key role in phospholipid biosynthesis. Catalyzes the first step in phosphatidylethanolamine biosynthesis. Phosphorylates ethanolamine, and can also act on choline (in vitro). Has higher activity with ethanolamine. May not significantly contribute to in vivo phosphatidylcholine biosynthesis.
  • PathwayPhospholipid metabolism; phosphatidylethanolamine biosynthesis; phosphatidylethanolamine from ethanolamine: step 1/3.
  • Sequence similaritiesBelongs to the choline/ethanolamine kinase family.
  • Information by UniProt

Recombinant Human CHKL protein images

  • 12.5% SDS-PAGE showing ab117004 at approx. 69.52 kDa.
    Stained with Coomassie Blue.

References for Recombinant Human CHKL protein (ab117004)

ab117004 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117004.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"