Recombinant Human CHMP2B protein (ab112405)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ9UQN3
    • SpeciesHuman
    • SequenceMASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMA KIGNKEACKVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAG AMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIF DGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISD EEIERQLKALGVD
    • Molecular weight49 kDa including tags
    • Amino acids1 to 213

Associated products

Specifications

Our Abpromise guarantee covers the use of ab112405 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • FormLiquid
  • Additional notesBest to use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • ALS17
    • Charged multivesicular body protein 2b
    • CHM2B_HUMAN
    • CHMP family, member 2B
    • CHMP2.5
    • CHMP2b
    • Chromatin modifying protein 2b
    • Chromatin-modifying protein 2b
    • DMT1
    • hVps2-2
    • Vacuolar protein sorting 2, yeast, homolog of, B
    • Vacuolar protein sorting 2-2
    • Vacuolar protein sorting-associated protein 2-2
    • VPS2 homolog B
    • Vps2-2
    • VPS2B
    see all
  • FunctionProbable core component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. The MVB pathway appears to require the sequential function of ESCRT-O, -I,-II and -III complexes. ESCRT-III proteins mostly dissociate from the invaginating membrane before the ILV is released. The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis and the budding of enveloped viruses (HIV-1 and other lentiviruses). ESCRT-III proteins are believed to mediate the necessary vesicle extrusion and/or membrane fission activities, possibly in conjunction with the AAA ATPase VPS4.
  • Tissue specificityWidely expressed. Expressed in brain, heart, skeletal muscle, spleen, kidney, liver, small intestine, pancreas, lung, placenta and leukocytes. In brain, it is expressed in cerebellum, cerebral cortex, medulla, spinal chord, occipital lobe, frontal lobe, temporal lobe and putamen.
  • Involvement in diseaseDefects in CHMP2B are the cause of frontotemporal dementia, chromosome 3-linked (FTD3) [MIM:600795]. FTD3 is characterized by an onset of dementia in the late 50's initially characterized by behavioral and personality changes including apathy, restlessness, disinhibition and hyperorality, progressing to stereotyped behaviors, non-fluent aphasia, mutism and dystonia, with a marked lack of insight. The brains of individuals with FTD3 have no distinctive neuropathological features. They show global cortical and central atrophy, but no beta-amyloid deposits.
  • Sequence similaritiesBelongs to the SNF7 family.
  • DomainThe acidic C-terminus and the basic N-termminus are thought to render the protein in a closed, soluble and inactive conformation through an autoinhibitory intramolecular interaction. The open and active conformation, which enables membrane binding and oligomerization, is achieved by interaction with other cellular binding partners, probably including other ESCRT components.
  • Cellular localizationCytoplasm > cytosol. Late endosome membrane.
  • Information by UniProt

Recombinant Human CHMP2B protein images

  • 12.5% SDS-PAGE analysis of ab112405. Stained with Coomassie Blue

References for Recombinant Human CHMP2B protein (ab112405)

ab112405 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112405.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"