Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSRVVSLLLGAALLCGHGAFCRRVVSGQKVCFADFKHPCYKMAYFHELSS RVSFQEARLACESEGGVLLSLENEAEQKLIESMLQNLTKPGTGISDGDFW IGLWRNGDGQTSGACPDLYQWSDGSNSQYRNWYTDEPSCGSEKCVVMYHQ PTANPGLGGPYLYQWNDDRCNMKHNYICKYEPEINPTAPVEKPYLTNQPG DTHQNVVVTEAGIIPNLIYVVIPTIPLLLLILVAFGTCCFQMLHKSKGRT KTSPNQSTLWISKSTRKESGMEV
    • Amino acids
      1 to 273
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165461 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C21orf68
    • Chodl
    • CHODL_HUMAN
    • Chondrolectin
    • Chromosome 21 open reading frame 68
    • FLJ12627
    • MT75
    • PRED12
    • Transmembrane protein MT75
    • UNQ872/PRO1890
    see all
  • Tissue specificity
    Found in spleen, testis, prostate and fetal liver. Expression limited to vascular muscle of testis, smooth muscle of prostate stroma, heart muscle, skeletal muscle, crypts of small intestine, and red pulp of spleen.
  • Sequence similarities
    Contains 1 C-type lectin domain.
  • Post-translational
    modifications
    N-glycosylated.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab165461 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165461 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165461.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up