Recombinant Human Chorionic Gonadotropin protein (ab158102)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      PALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTD CGGPKDHPLTCDDPRFQASSSSKAPPPSLPSPSRLPGPSDTPILPQ
    • Amino acids
      70 to 165
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158102 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Anterior pituitary glycoprotein hormones common subunit alpha
    • CG ALPHA
    • CG beta
    • CG beta a
    • CG-beta
    • CGA
    • CGB
    • CGB3
    • CGB5
    • CGB7
    • CGB8
    • CGHB_HUMAN
    • Choriogonadotropin alpha chain
    • Choriogonadotropin subunit beta
    • Chorionic gonadotrophin alpha subunit
    • Chorionic gonadotrophin chain beta
    • Chorionic gonadotropin alpha polypeptide
    • Chorionic gonadotropin beta 3 subunit
    • Chorionic gonadotropin beta 5 subunit
    • Chorionic gonadotropin beta 7 subunit
    • Chorionic gonadotropin beta 8 subunit
    • Chorionic gonadotropin beta chain
    • Chorionic gonadotropin beta polypeptide
    • Chorionic gonadotropin beta polypeptide 1
    • Chorionic gonadotropin beta polypeptide 2
    • Chorionic gonadotropin beta polypeptide 5
    • Chorionic gonadotropin beta polypeptide 7
    • Chorionic gonadotropin beta subunit
    • HCG
    • hCGB
    see all
  • Function
    Stimulates the ovaries to synthesize the steroids that are essential for the maintenance of pregnancy.
  • Tissue specificity
    Placenta.
  • Sequence similarities
    Belongs to the glycoprotein hormones subunit beta family.
  • Developmental stage
    Made by the first trimester placenta.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab158102 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158102 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158102.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up