Recombinant Human CHREBP protein (ab162408)

Overview

  • Product name
    Recombinant Human CHREBP protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      PPAPSGSERRLSGDLSSMPGPGTLSVRVSPPQPILSRGRPDSNKTENRRI THISAEQKRRFNIKLGFDTLHGLVSTLSAQPSLKVSKATTLQKTAEYI
    • Amino acids
      603 to 700
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162408 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • carbohydrate response element binding protein
    • bHLHd14
    • Carbohydrate responsive element binding protein
    • Class D basic helix-loop-helix protein 14
    • MIO
    • MLX interacting protein like
    • Mlx interactor
    • MLX-interacting protein-like
    • MLXIPL
    • MONDOB
    • WBS14_HUMAN
    • WBSCR 14
    • WBSCR14
    • Williams Beuren syndrome chromosome region 14
    • Williams Beuren syndrome chromosome region 14 protein
    • Williams-Beuren syndrome chromosomal region 14 protein
    • WS basic helix loop helix leucine zipper protein
    • WS basic-helix-loop-helix leucine zipper protein
    • WS bHLH
    • WS-bHLH
    see all
  • Function
    Transcriptional repressor. Binds to the canonical and non-canonical E box sequences 5'-CACGTG-3'.
  • Tissue specificity
    Expressed in liver, heart, kidney, cerebellum and intestinal tissues.
  • Involvement in disease
    Note=WBSCR14 is located in the Williams-Beuren syndrome (WBS) critical region. WBS results from a hemizygous deletion of several genes on chromosome 7q11.23, thought to arise as a consequence of unequal crossing over between highly homologous low-copy repeat sequences flanking the deleted region. Haploinsufficiency of WBSCR14 may be the cause of certain cardiovascular and musculo-skeletal abnormalities observed in the disease.
  • Sequence similarities
    Contains 1 basic helix-loop-helix (bHLH) domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab162408 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162408 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162408.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up