Recombinant Human CHRNA9 protein (ab163130)

Overview

  • Product name
    Recombinant Human CHRNA9 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MNWSHSCISFCWIYFAASRLRAAETADGKYAQKLFNDLFEDYSNALRPVE DTDKVLNVTLQITLSQIKDMDERNQILTAYLWIRQIWHDAYLTWDRDQYD GLDSIRIPSDLVWRPDIVLYNKADDESSEPVNTNVVLRYDGLITWDAPAI TKSSCVVDVTYFPFDNQQCNLTFGSWTYNGNQVDIFNALDSGDLSDFIED VEWEVHGMPAVKNVISYGCCSEPYPDVTFTLLLKRRSSFYIVNLLIPCVL ISFLAPLSFYLPAASGEKVSLGVTILLAMTVFQLMVAEIMPASENVPLIG KYYIATMALITASTALTIMVMNIHFCGAEARPVPHWARVVILKYMSRVLF VYDVGESCLSPHHSRERDHLTKVYSKLPESNLKAARNKDLSRKKDMNKRL KNDLGCQGKNPQEAESYCAQYKVLTRNIEYIAKCLKDHKATNSKGSEWKK VAKVIDRFFMWIFFIMVFVMTILIIARAD
    • Amino acids
      1 to 479
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163130 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cholinergic receptor nicotinic alpha 9
    • Cholinergic receptor nicotinic alpha polypeptide 9
    • HSA243342
    • MGC142109
    • MGC142135
    • NACHR alpha 9
    • NACHRA9
    • Neuronal acetylcholine receptor protein subunit alpha 9 precursor
    see all
  • Relevance
    CHRNA9 is a member of the ligand gated ionic channel family and nicotinic acetylcholine receptor superfamily. CHRNA9 forms homo- or hetero-oligomeric divalent cation channels. It is involved in cochlea hair cell development and is also expressed in the outer hair cells (OHCs) of the adult cochlea. The protein is additionally expressed in keratinocytes, the pituitary gland, B-cells and T-cells.
  • Cellular localization
    Membrane; multi pass membrane protein

Images

  • ab163130 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163130 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163130.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up