Recombinant Human Chromogranin C protein (ab192283)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SFQRNQLLQKEPDLRLENVQKFPSPEMIRALEYIENLRQQAHKEESSPDY NPYQGVSVPLQQKENGDESHLPERDSLSEEDWMRIILEALRQAENEPQSA PKENKPYALNSEKNFPMDMSDDYETQQWPERKLKHMQFPPMYEENSRDNP FKRTNEIVEEQYTPQSLATLESVFQELGKLTGPNNQKRERMDEEQKLYTD DEDDIYKANNIAYEDVVGGEDWNPVEEKIESQTQEEVRDSKENIEKNEQI NDEMKRSGQLGIQEEGLRKESKDQLSDDVSKVIAYLKRLVNAAGSGRLQN GQNGERATRLFEKPLDSQSIYQLIEISRNLQIPPEDLIEMLKTGEKPNGS VEPERELDLPVDLDDISEADLDHPDLFQNRMLSKSGYPKTPGGAGTEALP DGLSVEDILNLLGMESAANQKTSYFPNPYNQEKVLPRLPYGAGRSRSNQL PKAAWIPHVENRQMAYENLNDKDQELGEYLARMLVKYPEIINSNQVKRVP GQGSSEGDLQEEEQIEQAIKEHLNQGSSQETDKLAPVSKRFPVGPPKNDD TPNRQYWDEDLLMKVLEYLNQEKAEKGREHIAKRA MENMVDHHHHHH
    • Molecular weight
      69 kDa including tags
    • Amino acids
      29 to 617
    • Tags
      His tag C-Terminus
    • Additional sequence information
      This product is for the mature full length protein. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab192283 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Reconstitute for long term storage.

    pH: 7.4
    Constituents: 99% Phosphate Buffer, 0.87% Sodium chloride

  • Reconstitution
    Lyophilized protein should be stored at < -20°C.

General Info

  • Alternative names
    • CHGC
    • Chromogranin-C
    • EM66
    • SCG2
    • SCG2_HUMAN
    • Secretogranin II
    • Secretogranin-2
    • Secretoneurin
    • SGII
    • SN
    see all
  • Function
    Secretogranin-2 is a neuroendocrine secretory granule protein, which is the precursor for biologically active peptides.
  • Sequence similarities
    Belongs to the chromogranin/secretogranin protein family.
  • Cellular localization
    Secreted. Neuroendocrine and endocrine secretory granules.
  • Information by UniProt

References

ab192283 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab192283.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up