Recombinant Human CHST11 protein (ab153322)

Overview

  • Product name
    Recombinant Human CHST11 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      RKGDDVKFEEFVAYLIDPHTQREEPFNEHWQTVYSLCHPCHIHYDLVGKY ETLEEDSNYVLQLAGVGSYLKFPTYAKSTRTTDEMTTEFFQNISSEHQTQ LYEVYKLD
    • Amino acids
      230 to 337
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153322 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C4S-1
    • C4ST
    • C4ST 1
    • C4ST-1
    • C4ST1
    • Carbohydrate (chondroitin 4) sulfotransferase 11
    • Carbohydrate sulfotransferase 11
    • Chondroitin 4 O sulfotransferase 1
    • Chondroitin 4 sulfotransferase
    • Chondroitin 4-O-sulfotransferase 1
    • Chondroitin 4-sulfotransferase 1
    • CHST 11
    • Chst11
    • CHSTB_HUMAN
    • HSA269537
    • IgH/CHST11 fusion
    see all
  • Function
    Catalyzes the transfer of sulfate to position 4 of the N-acetylgalactosamine (GalNAc) residue of chondroitin. Chondroitin sulfate constitutes the predominant proteoglycan present in cartilage and is distributed on the surfaces of many cells and extracellular matrices. Can also sulfate Gal residues in desulfated dermatan sulfate. Preferentially sulfates in GlcA->GalNAc unit than in IdoA->GalNAc unit. Does not form 4, 6-di-O-sulfated GalNAc when chondroitin sulfate C is used as an acceptor.
  • Tissue specificity
    Widely expressed. Highly expressed in spleen, thymus, bone marrow, peripheral blood leukocytes, lymph node, heart, brain, lung and placenta.
  • Involvement in disease
    Note=A chromosomal aberration involving CHST11 is found in B-cell chronic lymphocytic leukemias. Translocation t(12;14)(q23;q32) with IgH.
  • Sequence similarities
    Belongs to the sulfotransferase 2 family.
  • Post-translational
    modifications
    N-glycosylated; required for activity and stability.
  • Cellular localization
    Golgi apparatus membrane.
  • Information by UniProt

Images

  • ab153322 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153322 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153322.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up