Overview

  • Product name
    Recombinant Human CHST2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      DPVKTLRRVYDFVGLLVSPEMEQFALNMTSGSGSSSKPFVVSARNATQAA NAWRTALTFQQIKQVEEFCYQPMAVLGYERVNSPEEVKDLSKTLLRKPRL
    • Amino acids
      431 to 530
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160485 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AI428561
    • AW121776
    • C130041E03Rik
    • C6ST
    • Carbohydrate (chondroitin 6/keratan) sulfotransferase 2
    • Carbohydrate (N-acetylglucosamine-6-O) sulfotransferase 2
    • Carbohydrate sulfotransferase 2
    • CHST2
    • CHST2_HUMAN
    • Chts2
    • Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 2
    • GlcNAc6ST
    • GlcNAc6ST-1
    • Gn6st
    • Gn6st-1
    • GST 2
    • GST-2
    • GST2
    • N-acetylglucosamine 6-O-sulfotransferase
    • N-acetylglucosamine 6-O-sulfotransferase 1
    see all
  • Function
    Catalyzes the transfer of sulfate to position 6 of non-reducing N-acetylglucosamine (GlcNAc) residues within keratan-like structures on N-linked glycans and within mucin-associated glycans that can ultimately serve as L-selectin ligands. L-selectin ligands are present in high endothelial cells (HEVs) and play a central role in lymphocyte homing at sites of inflammation. Participates in biosynthesis of L-selectin ligand sialyl 6-sulfo Lewis X and in lymphocyte homing to Peyer patches. Has no activity toward O-linked sugars. Its substrate specificity may be influenced by its subcellular location. Sulfates GlcNAc residues at terminal, non-reducing ends of oligosaccharide chains.
  • Tissue specificity
    Widely expressed. Highly expressed in bone marrow, peripheral blood leukocytes, spleen, brain, spinal cord, ovary and placenta. Expressed by high endothelial cells (HEVs) and leukocytes.
  • Sequence similarities
    Belongs to the sulfotransferase 1 family. Gal/GlcNAc/GalNAc subfamily.
  • Cellular localization
    Golgi apparatus > trans-Golgi network membrane.
  • Information by UniProt

Images

  • ab160485 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160485 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160485.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up