Overview

  • Product name
    Recombinant Human CHST3 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      VAFAGKYKTWKKWLDDEGQDGLREEEVQRLRGNCESIRLSAELGLRQPAW LRGRYMLVRYEDVARGPLQKAREMYRFAGIPLTPQVEDWIQKNTQAAHDG
    • Amino acids
      312 to 411
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160502 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C6ST
    • C6ST 1
    • C6ST-1
    • C6ST1
    • Carbohydrate (chondroitin 6) sulfotransferase 3
    • Carbohydrate sulfotransferase 3
    • Chondroitin 6 O sulfotransferase 1
    • Chondroitin 6 sulfotransferase
    • Chondroitin 6-O-sulfotransferase 1
    • Chondroitin 6-sulfotransferase
    • CHST 3
    • Chst3
    • CHST3_HUMAN
    • Galactose/N acetylglucosamine/N acetylglucosamine 6 O sulfotransferase 0
    • Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 0
    • GST 0
    • GST-0
    • GST0
    see all
  • Function
    Catalyzes the transfer of sulfate to position 6 of the N-acetylgalactosamine (GalNAc) residue of chondroitin. Chondroitin sulfate constitutes the predominant proteoglycan present in cartilage and is distributed on the surfaces of many cells and extracellular matrices. Can also sulfate Gal residues of keratan sulfate, another glycosaminoglycan, and the Gal residues in sialyl N-acetyllactosamine (sialyl LacNAc) oligosaccharides. May play a role in the maintenance of naive T-lymphocytes in the spleen.
  • Tissue specificity
    Widely expressed in adult tissues. Expressed in heart, placenta, skeletal muscle and pancreas. Also expressed in various immune tissues such as spleen, lymph node, thymus and appendix.
  • Involvement in disease
    Defects in CHST3 are a cause of spondyloepiphyseal dysplasia with congenital joint dislocations (SEDC-JD) [MIM:143095]. A bone dysplasia clinically characterized by dislocation of the knees and/or hips at birth, clubfoot, elbow joint dysplasia with subluxation and limited extension, short stature, and progressive kyphosis developing in late childhood. The disorder is usually evident at birth, with short stature and multiple joint dislocations or subluxations that dominate the neonatal clinical and radiographic picture. During childhood, the dislocations improve, both spontaneously and with surgical treatment, and features of spondyloepiphyseal dysplasia become apparent, leading to arthritis of the hips and spine with intervertebral disk degeneration, rigid kyphoscoliosis, and trunk shortening by late childhood.
  • Sequence similarities
    Belongs to the sulfotransferase 1 family. Gal/GlcNAc/GalNAc subfamily.
  • Cellular localization
    Golgi apparatus membrane.
  • Information by UniProt

Images

  • ab160502 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160502 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160502.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up