Overview

  • Product name
    Recombinant Human CHST5 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GSGIGKPIEAFHTSSRNARNVSQAWRHALPFTKILRVQEVCAGALQLLGY RPVYSADQQRDLTLDLVLPRGPDHFSWASPD
    • Amino acids
      310 to 390
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161691 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Carbohydrate (N acetylglucosamine 6 O) sulfotransferase 5
    • Carbohydrate sulfotransferase 5
    • Chst5
    • CHST5_HUMAN
    • FLJ22167
    • Galactose/N acetylglucosamine/N acetylglucosamine 6 O sulfotransferase 4 alpha
    • Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 4-alpha
    • GlcNAc6ST 3
    • GlcNAc6ST-3
    • Gn6st-3
    • GST4 alpha
    • GST4-alpha
    • hIGn6ST
    • I GlcNAc 6 ST
    • I GlcNAc6ST
    • I-GlcNAc6ST
    • IGlcNAc6ST
    • Intestinal GlcNAc 6 sulfotransferase
    • Intestinal GlcNAc-6-sulfotransferase
    • Intestinal GlcNAcv6 sulfotransferase
    • Intestinal N acetylglucosamine 6 O sulfotransferase
    • Intestinal N-acetylglucosamine-6-O-sulfotransferase
    • MGC74625
    • N acetylglucosamine 6 O sulfotransferase
    • N acetylglucosamine 6 O sulfotransferase 3
    • N-acetylglucosamine 6-O-sulfotransferase 3
    • OTTHUMP00000174950
    see all
  • Function
    Catalyzes the transfer of sulfate to position 6 of non-reducing N-acetylglucosamine (GlcNAc) residues and O-linked sugars of mucin-type acceptors. Acts on the non-reducing terminal GlcNAc of short carbohydrate substrates. However, it does not transfer sulfate to longer carbohydrate substrates that have poly-N-acetyllactosamine structures. Has no activity toward keratan. Not involved in generating HEV-expressed ligands for L-selectin. Its substrate specificity may be influenced by its subcellular location.
  • Tissue specificity
    Predominantly expressed in small and large intestines and colon. Weakly expressed in lymphocytes. Not expressed in other tissues. Down-regulated in colonic adenocarcinomas.
  • Sequence similarities
    Belongs to the sulfotransferase 1 family. Gal/GlcNAc/GalNAc subfamily.
  • Cellular localization
    Golgi apparatus membrane. Golgi membrane, early secretory pathway.
  • Information by UniProt

Images

  • ab161691 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161691 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161691.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up