Overview

  • Product name
    Recombinant Human CHST6 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      TPQLEAWIHNITHGSGPGARREAFKTSSRNALNVSQAWRHALPFAKIRRV QELCAGALQLLGYRPVYSEDEQRNLALDLVLPRGLNGFTWASSTASHPRN
    • Amino acids
      296 to 395
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158867 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C GlcNAc6ST
    • C-GlcNAc6ST
    • Carbohydate sulfotransferase 6
    • Carbohydrate (N acetylglucosamine 6 O) sulfotransferase 6
    • Carbohydrate sulfotransferase 6
    • CHST6
    • CHST6_HUMAN
    • Corneal GlcNAc6-sulfotransferase
    • Corneal N acetylglucosamine 6 sulfotransferase
    • Corneal N-acetylglucosamine-6-O-sulfotransferase
    • Galactose N acetylglucosamine N acetylglucosamine 6 O sulfotransferase 4 beta
    • Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 4-beta
    • GlcNAc6ST 5
    • GlcNAc6ST-5
    • Gn6st-5
    • GST4 beta
    • GST4-beta
    • hCGn6ST
    • N-acetylglucosamine 6-O-sulfotransferase 5
    see all
  • Function
    Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the transfer of sulfate to position 6 of non-reducing N-acetylglucosamine (GlcNAc) residues of keratan. Mediates sulfation of keratan in cornea. Keratan sulfate plays a central role in maintaining corneal transparency. Acts on the non-reducing terminal GlcNAc of short and long carbohydrate substrates that have poly-N-acetyllactosamine structures.
  • Tissue specificity
    Expressed in cornea. Mainly expressed in brain. Also expressed in spinal cord and trachea.
  • Involvement in disease
    Defects in CHST6 are the cause of macular dystrophy, corneal, 1 (MCDC1) [MIM:217800]. An ocular disease characterized by bilateral, progressive corneal opacification, and reduced corneal sensitivity. Onset occurs in the first decade, usually between ages 5 and 9. Painful attacks with photophobia, foreign body sensations, and recurrent erosions occur in most patients. The disease is due to deposition of an unsulfated keratan sulfate both within the intracellular space (within the keratocytes and endothelial cells) and in the extracellular corneal stroma. Macular corneal dystrophy is divided into the clinically indistinguishable types I, IA, and II based on analysis of the normally sulfated, or antigenic, keratan sulfate levels in serum and immunohistochemical evaluation of the cornea. Patients with types I and IA macular corneal dystrophy have undetectable serum levels of antigenic keratan sulfate, whereas those with type II macular corneal dystrophy have normal or low levels, depending on the population examined. Note=CHST6 homozygous missense mutations have been observed in patients with macular corneal dystrophy type I, while type II patients show a large deletion and replacement in the upstream region of CHST6. The only missense mutation for type II is Cys-50, which is heterozygous with a replacement in the upstream region on the other allele of CHST6.
  • Sequence similarities
    Belongs to the sulfotransferase 1 family. Gal/GlcNAc/GalNAc subfamily.
  • Cellular localization
    Golgi apparatus membrane.
  • Information by UniProt

Images

  • ab158867 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158867 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158867.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up