Overview

  • Product name
    Recombinant Human CHSY1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      PFQLPGSKSEHKEPKDKKINILIPLSGRFDMFVRFMGNFEKTCLIPNQNV KLVVLLFNSDSNPDKAKQVELMRDYRIKYPKADMQILPVSGEFSRALALE VGSSQFNNE
    • Amino acids
      516 to 624
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161443 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Carbohydrate synthase 1
    • Chondroitin glucuronyltransferase 1
    • Chondroitin glucuronyltransferase II
    • Chondroitin sulfate synthase 1
    • Chondroitin synthase 1
    • CHSS1_HUMAN
    • CHSY
    • ChSy-1
    • Chsy1
    • CSS1
    • Glucuronosyl-N-acetylgalactosaminyl-proteoglycan 4-beta-N-acetylgalactosaminyltransferase 1
    • N acetylgalactosaminyltransferase II
    • N-acetylgalactosaminyl-proteoglycan 3-beta-glucuronosyltransferase 1
    • N-acetylgalactosaminyltransferase 1
    • TPBS
    see all
  • Function
    Has both beta-1,3-glucuronic acid and beta-1,4-N-acetylgalactosamine transferase activity. Transfers glucuronic acid (GlcUA) from UDP-GlcUA and N-acetylgalactosamine (GalNAc) from UDP-GalNAc to the non-reducing end of the elongating chondroitin polymer.
  • Tissue specificity
    Ubiquitous, with the highest levels in placenta. Detected at low levels in brain, heart, skeletal muscle, colon, thymus, spleen, kidney, liver, adrenal gland, mammary gland, stomach, small intestine, lung and peripheral blood leukocytes.
  • Sequence similarities
    Belongs to the chondroitin N-acetylgalactosaminyltransferase family.
  • Cellular localization
    Golgi apparatus > Golgi stack membrane.
  • Information by UniProt

Images

  • ab161443 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161443 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161443.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up