Recombinant Human CHURC 1 protein (ab164867)

Overview

  • Product name
    Recombinant Human CHURC 1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MCGDCVGKEYPNRGNTCLENGSFLLNFTGCAVCSKRDFMLITNKSLKEED GEEIVTYDHLCKNCHHVIARHEYTFSIMDEFQEYTMLCLLCGKAEDTISI LPDDPRQMTLLF
    • Amino acids
      1 to 112
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164867 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C14orf52
    • CHCH
    • CHURC1
    • Churchill domain containing 1
    • FLJ33064
    • My015
    • Protein Churchill
    see all
  • Relevance
    CHURC 1 belongs to the Churchill family. It is a transcriptional activator that mediates FGF signaling during neural development. It plays a role in the regulation of cell movement, but does not bind DNA by itself. There are two named isoforms.

Images

  • ab164867 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164867 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164867.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up