Recombinant Human Chymotrypsin protein (ab153179)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ADKLQQGLQPVVDHATCSRIDWWGFRVKKTMVCAGGDGVISACNGDSGGP LNCQLENGSWEVFGIVSFGSRRGCNTRKKPVVYTRVSAYIDWINEKMQL
    • Amino acids
      170 to 268
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153179 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Caldecrin
    • Chymotrypsin C
    • Chymotrypsin-C
    • ChymotrypsinC
    • CLCR
    • Ctrc
    • CTRC_HUMAN
    • ELA 4
    • ELA4
    • Elastase 4
    • Elastase IV
    • Elastase4
    • ElastaseIV
    • OTTHUMP00000044526
    • Serum calcium decreasing factor
    see all
  • Function
    Has chymotrypsin-type protease activity and hypocalcemic activity.
  • Tissue specificity
    Pancreas.
  • Involvement in disease
    Variations in CTRC influence susceptibility to chronic pancreatitis [MIM:167800]. Chronic pancreatitis is a persistent inflammatory disorder characterized by permanent destruction of the pancreatic parenchyma.
  • Sequence similarities
    Belongs to the peptidase S1 family. Elastase subfamily.
    Contains 1 peptidase S1 domain.
  • Information by UniProt

Images

  • ab153179 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153179 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153179.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up