Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ13490
    • SpeciesHuman
    • SequenceMHKTASQRLFPGPSYQNIKSIMEDSTILSDWTNSNKQKMKYDFSCELYRM STYSTFPAGVPVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKLGDSPI QKHKQLYPSCSFIQNLVSASLGSTSKNTSPMRNSFAHSLSPTLEHSSLFS GSYSSLSPNPLNSRAVEDISSSRTNPYSYAMSTEEARFLTYHMWPLTFLS PSELARAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEHRRHFPNCPFL ENSLETLRFSISNLSMQTHAARMRTFMYWPSSVPVQPEQLASAGFYYVGR NDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFLIRMKGQEFVDEIQG RYPHLLEQLLSTSDTTGEENADPPIIHFGPGESSSEDAVMMNTPVVKSAL EMGFNRDLVKQTVQSKILTTGENYKTVNDIVSALLNAEDEKREEEKEKQA EEMASDDLSLIRKNRMALFQQLTCVLPILDNLLKANVINKQEHDIIKQKT QIPLQARELIDTILVKGNAAANIFKNCLKEIDSTLYKNLFVDKNMKYIPT EDVSGLSLEEQLRRLQEERTCKVCMDKEVSVVFIPCGHLVVCQECAPSLR KCPICRGIIKGTVRTFLS
    • Molecular weight94 kDa
    • Amino acids1 to 618

Specifications

Our Abpromise guarantee covers the use of ab114410 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • API 1
    • API1
    • Apoptosis inhibitor 1
    • Baculoviral IAP repeat containing 2
    • Baculoviral IAP repeat containing protein 2
    • Baculoviral IAP repeat-containing protein 2
    • BIRC 2
    • BIRC2
    • BIRC2_HUMAN
    • C IAP1
    • C-IAP1
    • cIAP 1
    • cIAP1
    • HIAP 2
    • HIAP-2
    • HIAP2
    • IAP 2
    • IAP homolog B
    • IAP-2
    • IAP2
    • Inhibitor of apoptosis protein 2
    • MIHB
    • NFR2 TRAF signalling complex protein
    • RING finger protein 48
    • RNF 48
    • RNF48
    • TNFR2 TRAF signaling complex protein 2
    • TNFR2-TRAF-signaling complex protein 2
    see all
  • FunctionApoptotic suppressor. The BIR motifs region interacts with TNF receptor associated factors 1 and 2 (TRAF1 and TRAF2) to form an heteromeric complex, which is then recruited to the tumor necrosis factor receptor 2 (TNFR2).
  • Tissue specificityPresent in many fetal and adult tissues. Mainly expressed in adult skeletal muscle, thymus, testis, ovary, and pancreas, low or absent in brain and peripheral blood leukocytes.
  • Sequence similaritiesBelongs to the IAP family.
    Contains 3 BIR repeats.
    Contains 1 CARD domain.
    Contains 1 RING-type zinc finger.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human cIAP1 protein images

  • 12.5% SDS-PAGE analysis of ab114410, stained with Coomassie Blue.

References for Recombinant Human cIAP1 protein (ab114410)

ab114410 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114410.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"