Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ13489
    • SpeciesHuman
    • SequenceMNIVENSIFLSNLMKSANTFELKYDLSCELYRMSTYSTFPAGVPVSERSL ARAGFYYTGVNDKVKCFCCGLMLDNWKRGDSPTEKHKKLYPSCRFVQSLN SVNNLEATSQPTFPSSVTNSTHSLLPGTENSGYFRGSYSNSPSNPVNSRA NQDFSALMRSSYHCAMNNENARLLTFQTWPLTFLSPTDLAKAGFYYIGPG DRVACFACGGKLSNWEPKDNAMSEHLRHFPKCPFIENQLQDTSRYTVSNL SMQTH
    • Molecular weight95 kDa including tags
    • Amino acids1 to 604
    • TagsGST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112252 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesBest use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl
    Note: Glutathione is reduced

General Info

  • Alternative names
    • AIP 1
    • AIP1
    • API 2
    • API2
    • Apoptosis inhibitor 2
    • Baculoviral IAP repeat containing 3
    • Baculoviral IAP repeat containing protein 3
    • Baculoviral IAP repeat-containing protein 3
    • BIRC 3
    • BIRC3
    • BIRC3_HUMAN
    • C IAP2
    • C-IAP2
    • CIAP 2
    • CIAP2
    • HAIP 1
    • HAIP1
    • HIAP 1
    • HIAP-1
    • HIAP1
    • IAP homolog C
    • IAP-1
    • Inhibitor of apoptosis protein 1
    • MALT 2
    • MALT2
    • Mammalian IAP homolog C
    • MIHC
    • RING finger protein 49
    • RNF49
    • TNFR2 TRAF signaling complex protein 1
    • TNFR2 TRAF signalling complex protein
    • TNFR2-TRAF-signaling complex protein 1
    see all
  • FunctionApoptotic suppressor. The BIR motifs region interacts with TNF receptor associated factors 1 and 2 (TRAF1 and TRAF2) to form an heteromeric complex, which is then recruited to the tumor necrosis factor receptor 2 (TNFR2).
  • Tissue specificityHighly expressed in fetal lung, and kidney. In the adult, expression is mainly seen in lymphoid tissues, including spleen, thymus and peripheral blood lymphocytes.
  • Involvement in diseaseNote=A chromosomal aberration involving BIRC3 is recurrent in low-grade mucosa-associated lymphoid tissue (MALT lymphoma). Translocation t(11;18)(q21;q21) with MALT1. This translocation is found in approximately 50% of cytogenetically abnormal low-grade MALT lymphoma.
  • Sequence similaritiesBelongs to the IAP family.
    Contains 3 BIR repeats.
    Contains 1 CARD domain.
    Contains 1 RING-type zinc finger.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human cIAP2 protein images

  • Coomassie blue stained 12.5% SDS page analysis of ab112252

References for Recombinant Human cIAP2 protein (ab112252)

ab112252 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112252.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"