Recombinant Human CIDE C protein (ab112421)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ96AQ7
    • SpeciesHuman
    • SequenceMEYAMKSLSLLYPKSLSRHVSVRTSVVTQQLLSEPSPKAPRARPCRVSTA DRSVRKGIMAYSLEDLLLKVRDTLMLADKPFFLVLEEDGTTVETEEYFQA LAGDTVFMVLQKGQKWQPPSEQGTRHPLSLSHKPAKKIDVARVTFDLYKL NPQDFIGRLNVKATFYDTYSLSYDLHCCGAKRIMKEAFRWALFSMQATGH VLLGTSCYLQQLLDATEEGQPPKGKASSLIPTCLKILQ
    • Molecular weight52 kDa including tags
    • Amino acids1 to 238

Specifications

Our Abpromise guarantee covers the use of ab112421 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • FormLiquid
  • Additional notesBest use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • Cell death activator
    • Cell death activator CIDE-3
    • Cell death inducing DFFA like effector C
    • Cell death inducing DFFA like effector protein C
    • Cell death-inducing DFFA-like effector protein C
    • CIDE 3
    • CIDE3
    • CIDEC
    • CIDEC_HUMAN
    • Fat specific protein 27
    • Fat-specific protein FSP27 homolog
    • FLJ20871
    • FPLD5
    • FSP27
    see all
  • FunctionInduces apoptosis.
  • Tissue specificityExpressed mainly in small intestine, heart, colon and stomach and, at lower levels, in brain, kidney and liver.
  • Sequence similaritiesContains 1 CIDE-N domain.
  • Cellular localizationCytoplasm. Cytoplasmic in a punctate manner.
  • Information by UniProt

Recombinant Human CIDE C protein images

  • ab112421 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human CIDE C protein (ab112421)

ab112421 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112421.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"