Recombinant Human CIDE C protein (ab112421)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MEYAMKSLSLLYPKSLSRHVSVRTSVVTQQLLSEPSPKAPRARPCRVSTA DRSVRKGIMAYSLEDLLLKVRDTLMLADKPFFLVLEEDGTTVETEEYFQA LAGDTVFMVLQKGQKWQPPSEQGTRHPLSLSHKPAKKIDVARVTFDLYKL NPQDFIGRLNVKATFYDTYSLSYDLHCCGAKRIMKEAFRWALFSMQATGH VLLGTSCYLQQLLDATEEGQPPKGKASSLIPTCLKILQ
    • Molecular weight
      52 kDa including tags
    • Amino acids
      1 to 238

Specifications

Our Abpromise guarantee covers the use of ab112421 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • Cell death activator
    • Cell death activator CIDE-3
    • Cell death inducing DFFA like effector C
    • Cell death inducing DFFA like effector protein C
    • Cell death-inducing DFFA-like effector protein C
    • CIDE 3
    • CIDE3
    • CIDEC
    • CIDEC_HUMAN
    • Fat specific protein 27
    • Fat-specific protein FSP27 homolog
    • FLJ20871
    • FPLD5
    • FSP27
    see all
  • Function
    Induces apoptosis.
  • Tissue specificity
    Expressed mainly in small intestine, heart, colon and stomach and, at lower levels, in brain, kidney and liver.
  • Sequence similarities
    Contains 1 CIDE-N domain.
  • Cellular localization
    Cytoplasm. Cytoplasmic in a punctate manner.
  • Information by UniProt

Images

  • ab112421 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab112421 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab112421.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up