Overview

  • Product name
    Recombinant Human CIITA protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      NSDADPLCLYHFYDQMDLAGEEEIELYSEPDTDTINCDQFSRLLCDMEGD EETREAYANIAELDQYVFQDSQLEGLSKDIFKHIGPDEVIGESMEMPAEV GQKSQKRPFP
    • Molecular weight
      38 kDa including tags
    • Amino acids
      39 to 148

Specifications

Our Abpromise guarantee covers the use of ab152530 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C2TA
    • C2TA_HUMAN
    • CIITA
    • CIITA IV
    • Class II major histocompatibility complex transactivator
    • Class II transactivator
    • MHC class II transactivator
    • MHC class II transactivator type III
    • MHC2TA
    • NLR family acid domain containing
    • NLRA
    • Nucleotide binding oligomerization domain leucine rich repeat and acid domain containing
    see all
  • Function
    Essential for transcriptional activity of the HLA class II promoter; activation is via the proximal promoter. No DNA binding of in vitro translated CIITA was detected. May act in a coactivator-like fashion through protein-protein interactions by contacting factors binding to the proximal MHC class II promoter, to elements of the transcription machinery, or both. Alternatively it may activate HLA class II transcription by modifying proteins that bind to the MHC class II promoter. Also mediates enhanced MHC class I transcription; the promoter element requirements for CIITA-mediated transcription are distinct from those of constitutive MHC class I transcription, and CIITA can functionally replace TAF1 at these genes. Exhibits intrinsic GTP-stimulated acetyltransferase activity. Exhibits serine/threonine protein kinase activity: can phosphorylate the TFIID component TAF7, the RAP74 subunit of the general transcription factor TFIIF, histone H2B at 'Ser-37' and other histones (in vitro).
  • Involvement in disease
    Bare lymphocyte syndrome 2
  • Sequence similarities
    Contains 4 LRR (leucine-rich) repeats.
    Contains 1 NACHT domain.
  • Domain
    The acetyltransferase domain is necessary for activation of both class I and class II transcription.
    The GTP-binding motif doesn't confer GTPase activity but promotes nuclear localization.
  • Post-translational
    modifications
    Autophosphorylated, affecting interaction with TAF7.
  • Cellular localization
    Nucleus. Nucleus, PML body. Recruited to PML body by PML.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152530 stained with Coomassie Blue.

References

ab152530 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152530.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up