Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LRDKTVMIIVAISPKYKQDVEGAESQLDEDEHGLHTKYIHRMMQIEFIKQ GSMNFRFIPVLFPNAKKEHVPTWLQNTHVYSWPKNKKNILLRLLREEEYV APPRGPLPTLQVVPL
    • Amino acids
      451 to 565
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161142 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Act 1
    • ACT1
    • Activator of cAMP responsive element modulator (CREM) in testis
    • Adapter protein CIKS
    • C6ORF4
    • C6ORF5
    • C6ORF6
    • Chromosome 6 Open Reading Frame 4
    • Chromosome 6 Open Reading Frame 5
    • Chromosome 6 Open Reading Frame 6
    • CIKS_HUMAN
    • Connection to IKK and SAPK / JNK
    • Connection to IKK and SAPK/JNK
    • Nuclear Factor Kappa B Activator 1
    • Nuclear factor NF kappa B activator 1
    • Nuclear factor NF-kappa-B activator 1
    • TRAF3 interacting protein 2
    • TRAF3-interacting protein 2
    • TRAF31P2
    • TRAF3IP2
    see all
  • Function
    Could be involved in the activation of both NF-kappa-B via a NF-kappa-B inhibitor kinase (IKK)-dependent mechanism and stress-activated protein kinase (SAPK)/JNK.
  • Tissue specificity
    Widely expressed.
  • Sequence similarities
    Contains 1 SEFIR domain.
  • Information by UniProt

Images

  • ab161142 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161142 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161142.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up