Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9BW66
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMEAKTLGTVTPRKPVLSVSARKIKDNAADW HNLILKWETLNDAGFTTANNIANLKISLLNKDKIELDSSSPASKENEEKV CLEYNEELEKLCEELQATLDGLTKIQVKMEKLSSTTKGICELENYHYGEE SKRPPLFHTWPTTHFYEVSHKLLEMYRKELLLKRTVAKELAHTGDPDLTL SYLSMWLHQPYVESDSRLHLESMLLETGHRAL
    • Molecular weight26 kDa including tags
    • Amino acids1 to 212
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109973 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab109973 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • CDK2-interacting protein
    • CINP
    • CINP protein
    • CINP_HUMAN
    • Cyclin dependent kinase 2 interacting protein
    • Cyclin-dependent kinase 2-interacting protein
    • MGC849
    see all
  • FunctionInteracts with the components of the replication complex and 2 kinases, CDK2 and CDC7, thereby providing a functional and physical link between CDK2 and CDC7 during firing of the origins of replication. Regulates ATR-mediated checkpoint signaling.
  • Sequence similaritiesBelongs to the CINP family.
  • Post-translational
    modifications
    Phosphorylated by CDC7 but not by CDK2.
  • Cellular localizationNucleus. Binds to nuclear under G1 conditions, and dissociates from chromatin with the start of DNA replication.
  • Information by UniProt

Recombinant Human CINP protein images

  • 15% SDS-PAGE analysis of 3 µg ab109973.

References for Recombinant Human CINP protein (ab109973)

ab109973 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab109973.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"