Overview

  • Product name
    Recombinant Human CINP protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMEAKTLGTVTPRKPVLSVSARKIKDNAADW HNLILKWETLNDAGFTTANNIANLKISLLNKDKIELDSSSPASKENEEKV CLEYNEELEKLCEELQATLDGLTKIQVKMEKLSSTTKGICELENYHYGEE SKRPPLFHTWPTTHFYEVSHKLLEMYRKELLLKRTVAKELAHTGDPDLTL SYLSMWLHQPYVESDSRLHLESMLLETGHRAL
    • Molecular weight
      26 kDa including tags
    • Amino acids
      1 to 212
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109973 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab109973 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • CDK2-interacting protein
    • CINP
    • CINP protein
    • CINP_HUMAN
    • Cyclin dependent kinase 2 interacting protein
    • Cyclin-dependent kinase 2-interacting protein
    • MGC849
    see all
  • Function
    Interacts with the components of the replication complex and 2 kinases, CDK2 and CDC7, thereby providing a functional and physical link between CDK2 and CDC7 during firing of the origins of replication. Regulates ATR-mediated checkpoint signaling.
  • Sequence similarities
    Belongs to the CINP family.
  • Post-translational
    modifications
    Phosphorylated by CDC7 but not by CDK2.
  • Cellular localization
    Nucleus. Binds to nuclear under G1 conditions, and dissociates from chromatin with the start of DNA replication.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab109973.

References

ab109973 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab109973.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up