Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSDPKNDSHVLIELHKSGFARPGDVEFED FSQPMNRAPSDSSLGTPSDGRPELRGPGRSRTKRWPFGKKNKTVVTEDFS HLPPEQQRKRLQQQLEERSRELQKEVDQREALKKMKDVYEKTPQMGDPAS LEPQIAETLSNIERLKLEVQKYEAWLAEAESRVLSNRGDSLSRHARPPDP PASAPPDSSSNSASQDTKESSEEPPSEESQDTPIYTEFDEDFEEEPTSPI GHCVAIYHFEGSSEGTISMAEGEDLSLMEEDKGDGWTRVRRKEGGEGYVP TSYLRVTLN
    • Molecular weight
      35 kDa including tags
    • Amino acids
      260 to 545
    • Tags
      His tag N-Terminus
    • Additional sequence information
      Isoform 2 of Cip4

Specifications

Our Abpromise guarantee covers the use of ab174408 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    >90% by SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

General Info

  • Alternative names
    • Cdc42 interacting protein 4
    • Cdc42 interaction protein 4 long isoform
    • Cdc42-interacting protein 4
    • CG11341
    • CG15015 PA
    • Cip 4
    • CIP4
    • CIP4_HUMAN
    • DCIP4
    • hSTP
    • Protein Felic
    • Salt tolerant protein
    • Salt tolerator
    • STOT
    • STP
    • Thyroid hormone receptor interactor 10
    • Thyroid receptor interacting protein 10
    • Thyroid receptor-interacting protein 10
    • TR-interacting protein 10
    • TRIP 10
    • TRIP-10
    • trip10
    • Truncated Cdc42 interaction protein 4
    see all
  • Function
    Required for translocation of GLUT4 to the plasma membrane in response to insulin signaling (By similarity). Required to coordinate membrane tubulation with reorganization of the actin cytoskeleton during endocytosis. Binds to lipids such as phosphatidylinositol 4,5-bisphosphate and phosphatidylserine and promotes membrane invagination and the formation of tubules. Also promotes CDC42-induced actin polymerization by recruiting WASL/N-WASP which in turn activates the Arp2/3 complex. Actin polymerization may promote the fission of membrane tubules to form endocytic vesicles. Required for the formation of podosomes, actin-rich adhesion structures specific to monocyte-derived cells. May be required for the lysosomal retention of FASLG/FASL.
  • Tissue specificity
    Expressed in brain, colon, heart, kidney, liver, lung, megakaryocyte, ovary, pancreas, peripheral blood lymphocytes, placenta, prostate, skeletal muscle, small intestine, spleen, testis, thymus and trachea.
  • Sequence similarities
    Belongs to the FNBP1 family.
    Contains 1 FCH domain.
    Contains 1 REM (Hr1) repeat.
    Contains 1 SH3 domain.
  • Post-translational
    modifications
    Tyrosine phosphorylated. Also phosphorylated by PKA.
  • Cellular localization
    Cytoplasm > perinuclear region and Cytoplasm > cytoskeleton. Cytoplasm > cell cortex. Lysosome. Golgi apparatus. Cell membrane. Cell projection > phagocytic cup. Translocates to the plasma membrane in response to insulin stimulation, and this may require active RHOQ (By similarity). Localizes to cortical regions coincident with F-actin, to lysosomes and to sites of phagocytosis in macrophages. Also localizes to the Golgi, and this requires AKAP9.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab174408 (3 µg).

References

ab174408 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174408.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up