Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMASDEGKLFVGGLSFDTNEQSLEQVFSKYG QISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVD QAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFES RSGGYGGSRDYYSSRSQSGGYSDRSSGGSYRDSYDSYATHNE
    • Molecular weight
      21 kDa including tags
    • Amino acids
      1 to 172
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab106903 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab106903 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.02% DTT, 50% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • A18 hnRNP
    • A18HNRNP
    • cirbp
    • CIRBP_HUMAN
    • CIRP
    • Cold inducible RNA binding protein
    • Cold-inducible RNA-binding protein
    • Glycine rich RNA binding protein
    • Glycine-rich RNA-binding protein CIRP
    • testicular tissue protein Li 39
    see all
  • Function
    Cold-inducible mRNA binding protein that plays a protective role in the genotoxic stress response by stabilizing transcripts of genes involved in cell survival. Acts as a translational activator. Seems to play an essential role in cold-induced suppression of cell proliferation. Binds specifically to the 3'-untranslated regions (3'-UTRs) of stress-responsive transcripts RPA2 and TXN. Acts as a translational repressor (By similarity). Promotes assembly of stress granules (SGs), when overexpressed.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Contains 1 RRM (RNA recognition motif) domain.
  • Domain
    Both the RRM domain and the arginine, glycine (RGG) rich domain are necessary for binding to the TXN 3'-untranslated region. Both the RRM domain and the arginine, glycine (RGG) rich domain (RGG repeats) are necessary for optimal recruitment into SGs upon cellular stress. The C-terminal domain containing RGG repeats is necessary for translational repression.
  • Post-translational
    modifications
    Methylated on arginine residues. Methylation of the RGG motifs is a prerequisite for recruitment into SGs.
    Phosphorylated by CK2, GSK3A and GSK3B. Phosphorylation by GSK3B increases RNA-binding activity to the TXN 3'-UTR transcript upon exposure to UV radiation.
  • Cellular localization
    Nucleus > nucleoplasm. Cytoplasm. Translocates from the nucleus to the cytoplasm after exposure to UV radiation. Translocates from the nucleus to the cytoplasm into stress granules upon various cytoplasmic stresses, such as osmotic and heat shocks. Its recruitment into stress granules occurs in the absence of TIAR proteins.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab106903 at approximately 20.8kDa (3µg).

References

ab106903 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab106903.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up