Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ9NSE2
    • SpeciesHuman
    • SequenceMVLCVQGPRPLLAVERTGQRPLWAPSLELPKPVMQPLPAGAFLEEVAEGT PAQTESEPKVLDPEEDLLCIAKTFSYLRESGWYWGSITASEARQHLQKMP EGTFLVRDSTHPSYLFTLSVKTTRGPTNVCIEYADSSFRLDSNCLSRPRI LAFPDVVSLVQHYVASCTADTRSDSPDPAPTPALPMPKEDAPSDPALPAP PPATAVHLKLVQPFVRRSSARSLQHLCRLVINRLVADVDCLPLPRRMAGY LRQYPFQL
    • Molecular weight54 kDa including tags
    • Amino acids1 to 258

Associated products

Specifications

Our Abpromise guarantee covers the use of ab117057 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BACTS2
    • CIS
    • cis 1
    • CIS-1
    • CIS1
    • Cish
    • CISH_HUMAN
    • Cytokine inducible inhibitor of signaling type 1B
    • Cytokine inducible SH2 containing protein
    • Cytokine-inducible SH2-containing protein
    • G18
    • Protein G18
    • SOCS
    • Suppressor of cytokine signaling
    see all
  • FunctionSOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. CIS is involved in the negative regulation of cytokines that signal through the JAK-STAT5 pathway such as erythropoietin, prolactin and interleukin 3 (IL3) receptor. Inhibits STAT5 trans-activation by suppressing its tyrosine phosphorylation. May be a substrate-recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
  • Tissue specificityExpressed in various epithelial tissues. Abundantly expressed in liver and kidney, and to a lesser extent in lung. The tissue distribution of isoforms 1 and 1B is distinct.
  • PathwayProtein modification; protein ubiquitination.
  • Sequence similaritiesContains 1 SH2 domain.
    Contains 1 SOCS box domain.
  • Post-translational
    modifications
    Association with EPOR may target the protein for proteolysis by the ubiquitin-dependent proteasome pathway. CIS is mainly monubiquitinated (37 kDa form) but may also exist in a polyubiquitinated form (45 kDa).
  • Information by UniProt

Recombinant Human CISH protein images

  • 12.5% SDS-PAGE showing ab117057 at approximately 54.49 kDa.
    Stained with Coomassie Blue.

References for Recombinant Human CISH protein (ab117057)

ab117057 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117057.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"