Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MVLCVQGPRPLLAVERTGQRPLWAPSLELPKPVMQPLPAGAFLEEVAEGT PAQTESEPKVLDPEEDLLCIAKTFSYLRESGWYWGSITASEARQHLQKMP EGTFLVRDSTHPSYLFTLSVKTTRGPTNVCIEYADSSFRLDSNCLSRPRI LAFPDVVSLVQHYVASCTADTRSDSPDPAPTPALPMPKEDAPSDPALPAP PPATAVHLKLVQPFVRRSSARSLQHLCRLVINRLVADVDCLPLPRRMAGY LRQYPFQL
    • Molecular weight
      54 kDa including tags
    • Amino acids
      1 to 258

Associated products

Specifications

Our Abpromise guarantee covers the use of ab117057 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BACTS2
    • CIS
    • cis 1
    • CIS-1
    • CIS1
    • Cish
    • CISH_HUMAN
    • Cytokine inducible inhibitor of signaling type 1B
    • Cytokine inducible SH2 containing protein
    • Cytokine-inducible SH2-containing protein
    • G18
    • Protein G18
    • SOCS
    • Suppressor of cytokine signaling
    see all
  • Function
    SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. CIS is involved in the negative regulation of cytokines that signal through the JAK-STAT5 pathway such as erythropoietin, prolactin and interleukin 3 (IL3) receptor. Inhibits STAT5 trans-activation by suppressing its tyrosine phosphorylation. May be a substrate-recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
  • Tissue specificity
    Expressed in various epithelial tissues. Abundantly expressed in liver and kidney, and to a lesser extent in lung. The tissue distribution of isoforms 1 and 1B is distinct.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Contains 1 SH2 domain.
    Contains 1 SOCS box domain.
  • Post-translational
    modifications
    Association with EPOR may target the protein for proteolysis by the ubiquitin-dependent proteasome pathway. CIS is mainly monubiquitinated (37 kDa form) but may also exist in a polyubiquitinated form (45 kDa).
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab117057 at approximately 54.49 kDa.
    Stained with Coomassie Blue.

References

ab117057 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab117057.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up