Recombinant Human CITED1 protein (ab152540)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MPTTSRPALDVKGGTSPAKEDANQEMSSVAYSNLAVKDRKAVAILHYPGV ASNGTKASGAPTSSSGSPIGSPTTTPPTKPPSFNLHPAPHLLASMQLQKL NSQYQGMAAATPGQPGEAGPLQNWDFGAQAGGAESLSPSAGAQSPAIIDS DPVDEEVLMSLVVELGLDRANELPELWLGQNEFDFTADFPSSC
    • Molecular weight
      47 kDa including tags
    • Amino acids
      1 to 193

Associated products

Specifications

Our Abpromise guarantee covers the use of ab152540 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ABCC1
    • AI316840
    • AU019144
    • Cbp/p300-interacting transactivator 1
    • Cbp/p300-interacting transactivator with GLU/ASP-rich C-terminal domain, 1
    • Cbp/p300-interacting transactivator with Glu/Asp-rich carboxy-terminal domain 1
    • CITE1_HUMAN
    • CITED1
    • melanocyte specific gene 1
    • Melanocyte specific protein 1
    • Melanocyte-specific protein 1
    • MSG1
    see all
  • Function
    Transcriptional coactivator of the p300/CBP-mediated trancription complex. Enhances SMAD-mediated transcription by strengthening the functional link between the DNA-binding SMAD transcription factors and the p300/CBP transcription coactivator complex. Stimulates estrogen-dependent transactivation activity mediated by estrogen receptors signaling; stabilizes the interaction of estrogen receptor ESR1 and histone acetyltransferase EP300. Positively regulates TGF-beta signaling through its association with the SMAD/p300/CBP-mediated transcriptional coactivator complex. Induces transcription from estrogen-responsive promoters and protection against cell death. Potentiates EGR2-mediated transcriptional activation activity from the ERBB2 promoter. Acts as an inhibitor of osteoblastic mineralization through a cAMP-dependent parathyroid hormone receptor signaling. May play a role in pigmentation of melanocytes. Associates with chromatin to the estrogen-responsive TGF-alpha promoter region in a estrogen-dependent manner.
  • Tissue specificity
    Expressed only in melanocytes and testis.
  • Sequence similarities
    Belongs to the CITED family.
  • Post-translational
    modifications
    Phosphorylated. Phosphorylation changes in a cell cycle-dependent manner and reduces its transcriptional coactivator activity.
  • Cellular localization
    Nucleus. Cytoplasm. Shuttles between the nucleus and the cytoplasm by a nuclear export signal and (NES) in a CRM1-dependent manner.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152540 stained with Coomassie Blue.

References

ab152540 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152540.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up