Recombinant Human Citrate synthetase protein (ab114400)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MDLIAKLPCVAAKIYRNLYREGSGIGAIDSNLDWSHNFTNMLGYTDHQFT ELTRLYLTIHSDHEGGNVSAHTSHLVGSALSDPYLSFAAAMNGLAGPLHG LANQEVLVWLTQLQKEVGKDVSDEKLRDYIWNTLNSGRVVPGYGHAVLRK TDPRYTCQREFALKHLPNDPMFKLVAQLYKIVPNVLLEQGKAKNPWPNVD AHSGVLLQYYGMTEMNYYTVLFGVSRALGVLAQLIWSRALGFPLERPKSM STEGLMKFVDSKSG
    • Molecular weight
      55 kDa including tags
    • Amino acids
      203 to 466

Specifications

Our Abpromise guarantee covers the use of ab114400 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.03% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CISY_HUMAN
    • Citrate synthase
    • Citrate synthase, mitochondrial
    • citrate synthetase
    • Cs
    • EC 2.3.3
    • EC 2.3.3.1
    see all
  • Pathway
    Carbohydrate metabolism; tricarboxylic acid cycle; isocitrate from oxaloacetate: step 1/2.
  • Sequence similarities
    Belongs to the citrate synthase family.
  • Cellular localization
    Mitochondrion matrix.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab114400, stained with Coomassie Blue.

References

ab114400 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114400.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up