Recombinant Human Citrate synthetase protein (ab114400)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MDLIAKLPCVAAKIYRNLYREGSGIGAIDSNLDWSHNFTNMLGYTDHQFT ELTRLYLTIHSDHEGGNVSAHTSHLVGSALSDPYLSFAAAMNGLAGPLHG LANQEVLVWLTQLQKEVGKDVSDEKLRDYIWNTLNSGRVVPGYGHAVLRK TDPRYTCQREFALKHLPNDPMFKLVAQLYKIVPNVLLEQGKAKNPWPNVD AHSGVLLQYYGMTEMNYYTVLFGVSRALGVLAQLIWSRALGFPLERPKSM STEGLMKFVDSKSG
    • Molecular weight
      55 kDa including tags
    • Amino acids
      203 to 466

Specifications

Our Abpromise guarantee covers the use of ab114400 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.03% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CISY_HUMAN
    • Citrate synthase
    • Citrate synthase, mitochondrial
    • citrate synthetase
    • Cs
    • EC 2.3.3
    • EC 2.3.3.1
    see all
  • Pathway
    Carbohydrate metabolism; tricarboxylic acid cycle; isocitrate from oxaloacetate: step 1/2.
  • Sequence similarities
    Belongs to the citrate synthase family.
  • Cellular localization
    Mitochondrion matrix.
  • Information by UniProt

Recombinant Human Citrate synthetase protein images

  • 12.5% SDS-PAGE analysis of ab114400, stained with Coomassie Blue.

References for Recombinant Human Citrate synthetase protein (ab114400)

ab114400 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114400.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up