Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ99426
    • SpeciesHuman
    • SequenceSLTIAEFKCKLELLVGSPASCMELELYGVDDKFYSKLDQEDALLGSYPVD DGCRIHVIDHSGARLGEYEDVSRVEKYTISQEAYDQRQDTVRSFLKRSKL
    • Molecular weight37 kDa including tags
    • Amino acids31 to 130

Specifications

Our Abpromise guarantee covers the use of ab117056 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CG22
    • CKAPI
    • Cytoskeleton associated protein 1
    • Cytoskeleton associated protein CKAPI
    • Cytoskeleton-associated protein 1
    • Cytoskeleton-associated protein CKAPI
    • Tbcb
    • TBCB_HUMAN
    • Tubulin folding cofactor B
    • Tubulin specific chaperone B
    • Tubulin-folding cofactor B
    • Tubulin-specific chaperone B
    see all
  • FunctionBinds to alpha-tubulin folding intermediates after their interaction with cytosolic chaperonin in the pathway leading from newly synthesized tubulin to properly folded heterodimer. Involved in regulation of tubulin heterodimer dissociation. May function as a negative regulator of axonal growth.
  • Tissue specificityFound in most tissues.
  • Sequence similaritiesBelongs to the TBCB family.
    Contains 1 CAP-Gly domain.
  • Post-translational
    modifications
    Phosphorylation by PAK1 is required for normal function. Phosphorylated upon DNA damage, probably by ATM or ATR.
    Ubiquitinated in the presence of GAN which targets it for degradation by the proteasome.
  • Cellular localizationCytoplasm. Cytoplasm > cytoskeleton. Colocalizes with microtubules. In differentiated neurons, located in the cytoplasm. In differentiating neurons, accumulates at the growth cone.
  • Information by UniProt

Recombinant Human CKAP1 protein images

  • 12.5% SDS-PAGE showing ab117056 at approximately 36.63 kDa.
    Stained with Coomassie Blue.

References for Recombinant Human CKAP1 protein (ab117056)

ab117056 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117056.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"