Overview

  • Product name
    Recombinant Human CKAP2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEKSEPVDQRRHTAGKAIVDSRSAQPKETSEERKARLSEWKAGKGRVLKR PPNSVVTQHEPAGQNEKPVGSFWTTMAEEDEQRLFTEKVNNTFSECLNLI NEGCPKEDILVTLNDLIKNIPDAKKLVKYWICLALIEPITSPIENIIAIY EKAILAGAQVR
    • Amino acids
      1 to 161
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162023 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AI461656
    • AW228814
    • CKAP 2
    • Ckap2
    • CKAP2_HUMAN
    • CTCL tumor antigen se20 10
    • CTCL tumor antigen se20-10
    • Cytoskeleton associated protein 2
    • Cytoskeleton-associated protein 2
    • DKFZp686L1238
    • FLJ10749
    • LB1
    • se20 10
    • TMAP
    • Tumor and microtubule associated protein
    • Tumor associated microtubule associated protein
    • Tumor- and microtubule-associated protein
    see all
  • Function
    Possesses microtubule stabilizing properties. Involved in regulating aneuploidy, cell cycling, and cell death in a p53/TP53-dependent manner.
  • Tissue specificity
    Abundant in testis, thymus, and in tumor derived cell lines, while barely detectable in liver, prostate, and kidney.
  • Sequence similarities
    Belongs to the CKAP2 family.
  • Developmental stage
    Present at the G1/S boundary. Accumulates as cells progress from S to G2 into mitosis. Rapidly degraded during mitosis exit by CDH1-activated anaphase promoting complex/cyclosome (APC/C).
  • Cellular localization
    Cytoplasm > cytoskeleton. Cytoplasm > cytoskeleton. Cytoplasm > cytoskeleton > spindle. Cytoplasm > cytoskeleton > spindle pole. Contrary to the ectopically expressed protein, endogenous CKAP2 does not colocalize with microtubules in G1, S and early G2. At late G2 and prophase after separation of duplicated centrosomes, colocalizes with gamma-tubulin and centrosome-proximal microtubules. From prometaphase through anaphase B, colocalizes with mitotic spindle poles and spindle microtubules. During cytokinesis, absent from midbody microtubules.
  • Information by UniProt

Images

  • ab162023 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162023 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162023.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up