Recombinant Human CKIP-1 protein (ab162446)

Overview

  • Product name
    Recombinant Human CKIP-1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MMKKNNSAKRGPQDGNQQPAPPEKVGWVRKFCGKGIFREIWKNRYVVLKG DQLYISEKEVKDEKNIQEVFDLSDYEKCEELRKSKSRSKKNHSKFTLAHS KQPGNTAPNLIFLAVSPEEKESWINALNSAITRAKNRILDEVTVEEDSYL AHPTRDRAKIQHSRRPPTRGHLMAVASTSTSDGMLTLDLIQEEDPSPEEP TSCAESFRVDLDKSVAQLAGSRRRADSDRIQPSADRASSLSRPWEKTDKG ATYTPQAPKKLTPTEKGRCASLEEILSQRDAASARTLQLRAEEPPTPALP NPGQLSRIQDLVARKLEETQELLAEVQGLGDGKRKAKDPPRSPPDSESEQ LLLETERLLGEASSNWSQAKRVLQEVRELRDLYRQMDLQTPDSHLRQTTP HSQYRKSLM
    • Amino acids
      1 to 409
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162446 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C-Jun-binding protein
    • Casein kinase 2-interacting protein 1
    • CK2 interacting protein 1
    • CK2 interacting protein 1 HQ0024c protein
    • CK2-interacting protein 1
    • CKIP 1
    • CKIP-1
    • CKIP1
    • JBP
    • OC120
    • Osteoclast maturation associated gene 120 protein
    • Osteoclast maturation-associated gene 120 protein
    • PH domain-containing family O member 1
    • PKHO1_HUMAN
    • Pleckstrin homology domain containing family O member 1
    • Pleckstrin homology domain-containing family O member 1
    • PLEKHO1
    see all
  • Function
    Plays a role in the regulation of the actin cytoskeleton through its interactions with actin capping protein (CP). May function to target CK2 to the plasma membrane thereby serving as an adapter to facilitate the phosphorylation of CP by protein kinase 2 (CK2). Appears to target ATM to the plasma membrane. Appears to also inhibit tumor cell growth by inhibiting AKT-mediated cell-survival. Also implicated in PI3K-regulated muscle differentiation, the regulation of AP-1 activity (plasma membrane bound AP-1 regulator that translocates to the nucleus) and the promotion of apoptosis induced by tumor necrosis factor TNF. When bound to PKB, it inhibits it probably by decreasing PKB level of phosphorylation.
  • Tissue specificity
    Abundantly expressed in skeletal muscle and heart, moderately in kidney, liver, brain and placenta and sparingly in the pancreas and lung. Easily detectable in cancer cell lines such as MOLT-4, HEK293 and Jurkat cells.
  • Sequence similarities
    Contains 1 PH domain.
  • Post-translational
    modifications
    C-terminal fragments could be released during apoptosis via caspase-3-dependent cleavage.
  • Cellular localization
    Cell membrane. Nucleus. Cytoplasm. Predominantly localized to the plasma membrane. In C2C12 cells, with the absence of growth factor, it is found in the nucleus. It rapidly translocates to the plasma membrane after insulin stimulation. In response to TNF, it translocates from the plasma membrane to the cytoplasm and then to the nucleus accompanied by cleavage by caspase-3. However, the subcellular location is highly dependent of the cell type, and this explains why it is found exclusively at the plasma membrane, in some type of cells.
  • Information by UniProt

Images

  • ab162446 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162446 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162446.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up