Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP17540
    • SpeciesHuman
    • SequenceMASIFSKLLTGRNASLLFATMGTSVLTTGYLLNRQKVCAEVREQPRLFPP SADYPDLRKHNNCMAECLTPAIYAKLRNKVTPNGYTLDQCIQTGVDNPGH PFIKTVGMVAGDEESYEVFADLFDPVIKLRHNGYDPRVMKHTTDLDASKI TQGQFDEHYVLSSRVRTGRSIRGLSLPPACTRAERREVENVAITALEGLK GDLAGRYYKLSEMTEQDQQRLIDDHFLFDKPVSPLLTCAGMARDWPDARG IWHNYDKTFLIWINEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQE RGWEFMWNERLGYILTCPSNLGTGLRAGVHVRIPKLSKDPRFSKILENLR LQKRGTGGVDTAAVADVYDISNIDRIGRSEVELVQIVIDGVNYLVDCEKK LERGQDIKVPPPLPQFGKK
    • Molecular weight72 kDa including tags
    • Amino acids1 to 419

Specifications

Our Abpromise guarantee covers the use of ab114749 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CKMT 2
    • Basic-type mitochondrial creatine kinase
    • CKMT2
    • CPK
    • Creatine kinase mitochondrial 2
    • Creatine kinase mitochondrial 2 (sarcomeric)
    • Creatine kinase S-type
    • creatine kinase S-type, mitochondrial
    • Creatine kinase, sarcomeric mitochondrial
    • KCRS_HUMAN
    • Mib CK
    • Mib-CK
    • mitochondrial
    • OTTHUMP00000147542
    • S-MtCK
    • Sarcomeric mitochondrial creatine kinase
    • SMTCK
    see all
  • FunctionReversibly catalyzes the transfer of phosphate between ATP and various phosphogens (e.g. creatine phosphate). Creatine kinase isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa.
  • Tissue specificitySarcomere-specific. Found only in heart and skeletal muscles.
  • Sequence similaritiesBelongs to the ATP:guanido phosphotransferase family.
    Contains 1 phosphagen kinase C-terminal domain.
    Contains 1 phosphagen kinase N-terminal domain.
  • Cellular localizationMitochondrion inner membrane.
  • Information by UniProt

Recombinant Human CKMT2 protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue showing ab114749 at approximately 71.83kDa.

References for Recombinant Human CKMT2 protein (ab114749)

ab114749 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114749.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"