Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASIFSKLLTGRNASLLFATMGTSVLTTGYLLNRQKVCAEVREQPRLFPP SADYPDLRKHNNCMAECLTPAIYAKLRNKVTPNGYTLDQCIQTGVDNPGH PFIKTVGMVAGDEESYEVFADLFDPVIKLRHNGYDPRVMKHTTDLDASKI TQGQFDEHYVLSSRVRTGRSIRGLSLPPACTRAERREVENVAITALEGLK GDLAGRYYKLSEMTEQDQQRLIDDHFLFDKPVSPLLTCAGMARDWPDARG IWHNYDKTFLIWINEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQE RGWEFMWNERLGYILTCPSNLGTGLRAGVHVRIPKLSKDPRFSKILENLR LQKRGTGGVDTAAVADVYDISNIDRIGRSEVELVQIVIDGVNYLVDCEKK LERGQDIKVPPPLPQFGKK
    • Molecular weight
      72 kDa including tags
    • Amino acids
      1 to 419

Specifications

Our Abpromise guarantee covers the use of ab114749 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CKMT 2
    • Basic-type mitochondrial creatine kinase
    • CKMT2
    • CPK
    • Creatine kinase mitochondrial 2
    • Creatine kinase mitochondrial 2 (sarcomeric)
    • Creatine kinase S-type
    • creatine kinase S-type, mitochondrial
    • Creatine kinase, sarcomeric mitochondrial
    • KCRS_HUMAN
    • Mib CK
    • Mib-CK
    • mitochondrial
    • OTTHUMP00000147542
    • S-MtCK
    • Sarcomeric mitochondrial creatine kinase
    • SMTCK
    see all
  • Function
    Reversibly catalyzes the transfer of phosphate between ATP and various phosphogens (e.g. creatine phosphate). Creatine kinase isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa.
  • Tissue specificity
    Sarcomere-specific. Found only in heart and skeletal muscles.
  • Sequence similarities
    Belongs to the ATP:guanido phosphotransferase family.
    Contains 1 phosphagen kinase C-terminal domain.
    Contains 1 phosphagen kinase N-terminal domain.
  • Cellular localization
    Mitochondrion inner membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE Stained with Coomassie Blue showing ab114749 at approximately 71.83kDa.

References

ab114749 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114749.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up