Overview

Description

  • NatureRecombinant
  • SourceSaccharomyces cerevisiae
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceMSHKQIYYSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESE WRNLGV QQSQGWVHYMIHEPEPHILLFRRPLPKKPKK

Associated products

Specifications

Our Abpromise guarantee covers the use of ab88046 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5

General Info

  • Alternative names
    • CDC2 associated protein CKS1
    • CDC28 protein kinase 1
    • CDC28 protein kinase 1B
    • CDC28 protein kinase regulatory subunit 1B
    • Cell division control protein CKS1
    • CKS 1
    • CKS-1
    • CKS1
    • CKS1_HUMAN
    • Cks1b
    • Ckshs1
    • Cyclin dependent kinases regulatory subunit 1
    • Cyclin-dependent kinases regulatory subunit 1
    • NB4 apoptosis/differentiation related protein
    • PNAS 143
    • PNAS 16
    • PNAS 18
    see all
  • FunctionBinds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function.
  • Sequence similaritiesBelongs to the CKS family.
  • Information by UniProt

Recombinant Human CKS1 protein images

  • Lane 1: CKS1 protein 35kDa (9.7kDa with 26kDa tag), Lane 2: Marker, 12% SDS-PAGE

References for Recombinant Human CKS1 protein (ab88046)

ab88046 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab88046.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"