Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLLKKHAGKGGGREPRSEDPTPAEQHCARTMPPCAVLAALLSVVAVVSCL YLGVKTNDLQARIAALESAKGAPSIHLLPDTLDHLKTMVQEKVERLLAQK SYEHMAKIRIAREAPSECNCPAGPPGKRGKRGRRGESGPPGQPGPQGPPG PKGDKGEQGDQGPRGPLGPPGQKGSIGAPGIPGMNGQKGEPGLPGAVGQN GIPGPKGEPGEQGEKGDAGENGPKGDTGEKGDPGSSAAGIKGEPGESGRP GQKGEPGLPGLPGLPGIKGEPGFIGPQGEPGLPGLPGTKGERGEAGPPGR GERGEPGAPGPKGKQGESGTRGPKGSKGDRGEKGDSGAQGPRGPPGQKGD QGATEIIDYNGNLHEALQRITTLTVTGPPGPPGPQGLQGTKGEQGSPGIP GMDGEQGLKGSKGDMGDPGSQWNERRKRRFWNAGSTGSFYHRPTRPTRSP WPTWPHGTSWTSWTKGSIWLRRKARIPGYRWSYGTPWPCRSQRRKR
    • Amino acids
      1 to 496
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164614 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Alzheimer disease amyloid associated protein
    • Alzheimer disease amyloid-associated protein
    • AMY
    • CLAC
    • CLAC P
    • CLAC precursor
    • CLAC-P
    • Col25a1
    • COL25A1 protein
    • Collagen alpha 1 XXV chain
    • Collagen alpha 1(XXV) chain
    • Collagen like Alzheimer amyloid plaque component
    • Collagen like Alzheimer amyloid plaque component precursor
    • Collagen type XXV alpha 1
    • Collagen-like Alzheimer amyloid plaque component
    • Collagenous Alzheimer amyloid plaque component
    • COPA1_HUMAN
    see all
  • Function
    Inhibits fibrillization of beta amyloid peptide during the elongation phase. Has also been shown to assemble amyloid fibrils into protease-resistant aggregates. Binds heparin.
  • Tissue specificity
    Expressed predominantly in brain. Deposited preferentially in primitive or neuritic amyloid plaques which are typical of Alzheimer disease.
  • Sequence similarities
    Contains 7 collagen-like domains.
  • Post-translational
    modifications
    Undergoes proteolytic cleavage by furin protease to yield the soluble collagen-like Alzheimer amyloid plaque component.
    Glycosylated.
    Hydroxylated on 11% of proline residues and 49% of lysine residues.
  • Cellular localization
    Membrane. After proteolytic cleavage, CLAC is secreted.
  • Information by UniProt

Images

  • ab164614 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164614 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164614.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up