Recombinant Human Clathrin heavy chain protein (ab112271)

Overview

  • Product name
    Recombinant Human Clathrin heavy chain protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      EVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGY IHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEE ENIIPYITN
    • Molecular weight
      38 kDa including tags
    • Amino acids
      232 to 340
    • Tags
      GST tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab112271 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    useful for Antibody Production and Protein Array
  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Best use within three months from the date of receipt of this protein.useful for Antibody Production and Protein Array
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione
    Note: Glutathione is reduced

General Info

  • Alternative names
    • CHC17
    • Clathrin heavy chain
    • Clathrin heavy chain 1
    • Clathrin heavy chain 2
    • Clathrin heavy chain like 1
    • Clathrin heavy chain on chromosome 17
    • Clathrin heavy polypeptide
    • CLH 17
    • CLH 22
    • CLH-17
    • CLH1_HUMAN
    • CLH17
    • CLH22
    • CLTC
    • CLTCL
    • CLTCL1
    • CLTCL2
    • CLTD
    • Hc
    • KIAA0034
    see all
  • Function
    Clathrin is the major protein of the polyhedral coat of coated pits and vesicles. Two different adapter protein complexes link the clathrin lattice either to the plasma membrane or to the trans-Golgi network.
  • Sequence similarities
    Belongs to the clathrin heavy chain family.
  • Cellular localization
    Cytoplasmic vesicle membrane. Membrane > coated pit. Melanosome. Cytoplasmic face of coated pits and vesicles. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt

Recombinant Human Clathrin heavy chain protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human Clathrin heavy chain protein (ab112271)

ab112271 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112271.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up